SecReT4
Protein ID: 91206076
T4SS name [ID]VirB [492]
Gene symbolvirB6-5
Locus tagRBE_1261
StrainRickettsia bellii RML369-C
Repliconchromosome [GenBank: NC_007940] [Browse all T4SS(s) in this replicon]
Location [Strand]1351723..1355196 [-]
ProductVirB6
Component typeVirB6
UniProt IDQ1RH22
KEGG IDrbe:RBE_1261
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 7.8e-23, Aligned region: 298..483
Protein Sequence: 1157 a.a.     [Download]
>gi|91206076|ref|YP_538431.1| VirB6 [Rickettsia bellii RML369-C]
MNRNIFITLLISLLALSGCSGDTCIDPDDFGFIKFNISSRYDPSEVTSRQEGDQVAPWRDSAYKVNGYPL
TIMVRPWDYMSGDKNTSGMLSAWCPWYGQQNNFTTLAEFCVRLRPCQFTDGKMCPTPTPRDAPINNAPCI
LTNGVGLYFLIADKGSNPNMSPDSQRSPKGITQHLGEPVASQDYEFYSISSTGKFLQAGGINYQYGCTSL
PCDQASNYAQSSLYFKILDKFYDDNSGQYRVVIKSGVSDTRPDPLQFLTNLIKNELFGTSDKDPGIVRQT
YQQIIETPGYRLSVSALLTLYIMFTGFSFLIGNINMTHVELVVRILKVSVVSILLSTSKAWTFFHDYLFV
FFVEGLAQILQIVQDASTGQSLLSLLISPQTLSKLFSLLFVDPLGFIYIILYLIALYFIFLLIFKATIIY
LTALITIGMIITMAPIFICFMLFNITRSLFENWLRQLISYAIQPIILFVGIAFIGMIIKTEIQSTLGFAV
CKKDFPDLGPINQIFGSFTEDLDSSIGNSIFYWWFPVPMKGGIENFTQADILVPEDYTKKDGTKCLAYQC
IDKRYIQLPFLDLVKDANRISNFINGKFVQLDGLLLIFVSIYLLSKFNDTAISTASFIAGTSGNLTSIQA
VNQQSYDSIMKQVNRPINYATGVISKPINRMQEQTSMFFAEKYQGLMMSRLENKALSSSANKAVQNEVKR
KYGIDHKDVNMQAGADYKNGISKLLDNKTFLPKGGDLDVKKLATMNFGQLRDEFAKNKYGAKNYSSLTSD
QKLELDKFMKSDLGEKGKSAKSLRELASDANFTRDYQSAYKYAHKEMSGRGVGLFGKNIGVLRSWQEMEN
RMKTKRELKEQKRVAIGEKIYAGYTGLKRDALTAIVGKDLRDKYEGNLTSAEWHDFDYNDPQLRTYSESL
KDKERAREVKELQMQINKETLAVQEDILSPEYLARLKRPSDVEYYQELGQRRLIHEVRDRLSEGSDPVIM
GDRFMQEKATDDQMRTMIDNAHQKHAEFIDQDRYTRRQEHYDIMHEKAQENIDRTYKEIKDHFKRDDIKL
EEMPALIAQYEREKPIESFDSKTELSLDKRIEEAVSNFNINAKNYEYSASVLNNIEERKQAITDEVNTQI
DRINKYRENAKMPQYQKPVENSGRKLRKLEDHLRNMK
 
Nucleotide Sequence: 3474 bp     [Download]
>gi|91204815|ref|NC_007940.1|:c1355196-1351723 Rickettsia bellii RML369-C chromosome, complete genome
ATGAACAGAAATATTTTTATTACATTATTAATATCGTTATTGGCACTGTCGGGGTGCAGCGGGGATACTT
GTATCGATCCGGATGATTTCGGTTTTATAAAATTTAATATTTCTTCTAGATATGATCCATCTGAAGTTAC
TTCAAGACAAGAGGGGGATCAGGTAGCACCATGGCGGGATAGTGCTTATAAAGTAAATGGTTATCCTTTA
ACAATTATGGTAAGACCTTGGGATTATATGTCTGGGGACAAGAATACTTCAGGGATGTTATCAGCATGGT
GTCCATGGTATGGGCAGCAGAATAATTTTACTACCTTAGCTGAGTTTTGTGTTAGACTGCGACCATGTCA
ATTTACTGACGGTAAGATGTGTCCAACTCCTACGCCAAGAGATGCACCTATTAATAATGCTCCTTGTATA
CTTACAAACGGAGTAGGGCTTTATTTTTTAATTGCTGATAAAGGTTCTAATCCTAATATGTCGCCAGATT
CACAGCGTAGTCCGAAAGGTATAACGCAGCATTTAGGTGAACCAGTTGCAAGCCAAGATTATGAATTTTA
TAGTATTAGTAGTACTGGAAAGTTTTTACAAGCCGGTGGTATAAATTACCAATATGGTTGTACTAGCCTA
CCTTGCGATCAAGCTTCAAATTATGCTCAATCTTCTCTATATTTTAAAATTTTAGACAAATTTTATGATG
ATAATAGTGGACAATATAGGGTAGTAATAAAATCCGGAGTCAGCGATACAAGACCTGATCCCCTACAATT
TTTAACAAATTTAATAAAGAATGAGTTATTTGGTACTAGCGATAAAGATCCTGGAATTGTAAGGCAAACT
TATCAGCAAATAATTGAAACACCTGGCTATAGGTTAAGTGTTTCGGCTCTTTTAACTCTTTATATAATGT
TTACTGGATTTTCCTTTTTAATAGGAAACATAAACATGACTCATGTTGAGTTAGTAGTTAGAATACTAAA
AGTCAGTGTAGTTTCAATATTATTAAGTACAAGTAAAGCTTGGACATTTTTCCATGATTATTTATTTGTA
TTTTTTGTTGAAGGGCTAGCACAGATATTACAAATAGTACAAGATGCTTCAACAGGGCAAAGTTTACTAA
GCCTTCTTATTTCCCCGCAAACTTTATCTAAGCTATTTTCTTTATTGTTTGTAGATCCGCTTGGGTTTAT
TTATATCATACTATATTTAATAGCTCTGTATTTTATTTTCTTACTTATATTCAAAGCTACAATTATTTAT
CTTACTGCATTAATAACCATTGGTATGATTATAACAATGGCACCGATATTTATTTGTTTCATGTTATTTA
ATATAACTAGATCGTTATTTGAAAATTGGTTAAGGCAATTAATATCATATGCTATACAACCTATAATTTT
ATTTGTCGGTATTGCTTTTATCGGAATGATTATTAAAACAGAAATACAATCGACATTAGGTTTTGCCGTC
TGTAAGAAAGATTTCCCCGATTTAGGACCTATAAATCAAATTTTTGGTAGTTTTACAGAAGATTTAGATT
CAAGTATTGGTAATTCGATATTTTATTGGTGGTTTCCGGTACCGATGAAAGGAGGAATTGAGAATTTCAC
TCAAGCAGATATATTAGTCCCCGAAGATTATACCAAAAAGGATGGTACTAAGTGTTTGGCATATCAATGT
ATAGATAAACGTTATATTCAATTACCGTTTTTAGACTTAGTTAAAGATGCAAATAGAATTAGTAATTTTA
TAAATGGTAAATTCGTCCAGCTTGATGGCTTATTATTGATATTTGTTTCTATTTATTTGCTTAGTAAATT
TAATGATACTGCTATATCGACGGCTAGTTTTATTGCGGGTACTTCGGGTAATTTAACATCGATACAGGCT
GTTAACCAGCAATCTTACGATTCTATCATGAAGCAGGTCAATAGACCGATAAATTATGCAACAGGAGTTA
TTAGTAAGCCGATAAACCGAATGCAAGAGCAAACGAGTATGTTTTTTGCTGAAAAATATCAAGGGCTTAT
GATGAGTAGGCTTGAAAATAAAGCCCTCAGTTCTTCGGCTAACAAAGCAGTGCAAAATGAAGTTAAAAGA
AAATATGGTATAGACCATAAAGACGTTAATATGCAAGCCGGAGCAGATTATAAAAACGGCATTTCTAAAT
TGCTAGATAATAAAACGTTTTTACCGAAAGGTGGTGATTTAGATGTGAAAAAACTAGCAACTATGAATTT
TGGGCAGCTTCGAGATGAATTTGCCAAAAATAAATATGGTGCAAAAAATTATAGCTCTTTAACTAGTGAT
CAGAAACTAGAGCTTGATAAATTCATGAAATCCGATTTAGGTGAGAAAGGTAAATCAGCAAAAAGCTTAC
GTGAGCTTGCAAGTGATGCAAACTTTACTAGAGATTATCAAAGTGCTTATAAATATGCTCATAAAGAAAT
GTCAGGAAGAGGAGTTGGTCTATTTGGTAAAAATATAGGAGTGCTTAGAAGCTGGCAAGAAATGGAAAAT
CGCATGAAAACTAAACGTGAATTAAAAGAACAAAAACGTGTAGCTATAGGTGAGAAAATATATGCCGGCT
ATACAGGATTAAAAAGAGATGCTCTTACTGCGATAGTTGGTAAAGATTTACGTGATAAATATGAGGGTAA
TCTAACTAGTGCCGAGTGGCATGACTTTGACTATAACGATCCACAGCTTAGAACTTATAGCGAAAGTCTA
AAAGATAAAGAAAGAGCACGAGAAGTCAAAGAGCTTCAAATGCAGATTAATAAAGAAACGCTTGCTGTTC
AAGAAGATATATTATCGCCTGAATATTTAGCAAGATTAAAAAGACCAAGTGATGTAGAATATTATCAGGA
ATTAGGTCAAAGAAGGCTTATTCATGAAGTGCGTGATAGATTATCTGAAGGAAGTGATCCAGTGATAATG
GGTGATAGATTTATGCAAGAAAAAGCTACCGATGATCAAATGCGGACTATGATAGATAATGCTCATCAAA
AACATGCAGAATTTATAGATCAAGATAGATATACTCGTCGTCAAGAGCATTACGATATTATGCATGAAAA
AGCTCAAGAAAATATCGACAGAACTTATAAAGAGATTAAAGATCATTTCAAAAGAGATGATATTAAGCTT
GAGGAAATGCCAGCTTTAATAGCACAATATGAAAGAGAGAAACCAATAGAATCTTTTGATAGTAAGACAG
AGCTTTCTCTAGATAAAAGGATTGAAGAAGCAGTTAGTAACTTTAATATCAATGCTAAAAATTATGAATA
TAGTGCATCGGTGCTTAATAATATAGAAGAAAGAAAGCAGGCTATTACTGATGAAGTAAATACTCAAATT
GATCGAATTAATAAATATAGAGAAAATGCTAAAATGCCGCAATACCAGAAACCGGTAGAAAATTCAGGAA
GAAAGCTCAGAAAATTAGAAGACCATTTGAGAAATATGAAGTAA
 Primer design

Protein ID: 91206077
T4SS name [ID]VirB [492]
Gene symbolvirB6-4
Locus tagRBE_1262
StrainRickettsia bellii RML369-C
Repliconchromosome [GenBank: NC_007940] [Browse all T4SS(s) in this replicon]
Location [Strand]1355366..1358026 [-]
ProductVirB6
Component typeVirB6
UniProt IDQ1RH21
KEGG IDrbe:RBE_1262
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.4e-19, Aligned region: 516..711
Protein Sequence: 886 a.a.     [Download]
>gi|91206077|ref|YP_538432.1| VirB6 [Rickettsia bellii RML369-C]
MKIIKSLILLVLFMASPAKGDDFAWMSSGLSGLKSIFGCLEVPTFTSFQEGKIGISLSTAGDWQSTGNAV
EKGKLLKIKWSTAGLTPEPRKYLVLYRIDPRFSVPQVFIKTYNYKNSQFEVAGFPGFSTANDGVIPPDKN
LDALSFTKMNNYVNYFNYANGNPKIQVNVGDIVNISLADKDDFFNPSTSKTPSTLNNILAKELDSSVFAA
SALYTESNLGNFENRIVYSSAEQVCNIIDAQRATLCTGTGSATKYTNVSNGALVGKPMAVTTLQNFMSMI
NSCPANSNLNANPSCYYDQGRGMVIKIGGQVIKNRDQSFVNNDNTQNGFMYYQATSGGAMDFSSDWQPTG
MFNNSFSMSDWSRNFSNYTDFATYITNGNWATNFLYFGRYAMIVEIGNGTNTISPGDQKNITLEYLITAD
GTLPSSSTPGTTVGYDFSGDAPQDGYLWLRVKNPNSNIQGTISVDYANYTGTTWFSNIVYNGAIKPITDQ
FRTYSEDFYFKLVANSAIQNIAKTALTLYVTIFGLMFVLGALKLTAVEVVTRIFKITIVAILLRPESWSF
FNNNFFSAFINGIDFFATNVVGATSSKSNIFGFIDPIFDKYTNGRIWGLLFIQLLQIHNGLAFIVIITIY
SLITYFRAVLEVIIGYVIAFIGLTVMISLAPFFIILMLFEKTKTMFNNWISILFSYVVQPTILLIFFLLI
DQILSEQLLKVIVRACWDTLIPIKIGLDLSNLGIPLNFSFTLPFLPGIPFFVPQVPDITSSNILTNDTNT
FLVLFTTALLFYSYCLMSYGLVSFVTIVVGMLTQVTPARIEGNYQAPSNPTESIMKDIGSVAAPIKKAAL
APARIFKDKVIDQNYEARKPQGGGEHTGKFFQNRNDVKPEQTERND
 
Nucleotide Sequence: 2661 bp     [Download]
>gi|91204815|ref|NC_007940.1|:c1358026-1355366 Rickettsia bellii RML369-C chromosome, complete genome
ATGAAAATTATTAAAAGTTTAATTTTATTAGTTTTATTTATGGCGTCGCCTGCCAAAGGTGATGACTTTG
CTTGGATGTCAAGTGGGCTTAGCGGTCTTAAAAGCATTTTTGGTTGTTTAGAAGTACCTACATTTACAAG
TTTCCAAGAGGGTAAAATAGGTATTAGTTTATCGACTGCTGGAGATTGGCAATCAACAGGTAATGCAGTT
GAAAAAGGTAAGCTGCTTAAGATTAAATGGTCTACTGCAGGTCTTACCCCAGAGCCTCGAAAATATCTAG
TATTATATAGAATTGACCCAAGGTTTAGTGTTCCGCAAGTCTTTATAAAAACTTATAATTACAAAAACTC
ACAGTTTGAAGTTGCAGGATTCCCAGGTTTTAGTACAGCAAATGATGGTGTTATACCTCCTGATAAAAAC
CTTGATGCATTATCATTTACTAAGATGAATAATTATGTTAACTACTTTAATTATGCTAATGGTAATCCAA
AAATTCAGGTTAATGTTGGTGATATAGTAAATATTAGTCTAGCTGATAAAGATGATTTTTTTAATCCAAG
TACATCAAAAACTCCAAGCACCTTAAATAATATACTAGCTAAAGAACTCGATAGTTCTGTATTTGCTGCT
TCTGCTCTTTATACTGAAAGCAATCTTGGTAATTTTGAAAATAGGATAGTTTACTCAAGTGCAGAGCAAG
TTTGTAATATTATAGATGCTCAAAGAGCAACTTTATGTACTGGTACAGGTTCGGCTACAAAATATACTAA
TGTTAGTAATGGTGCATTAGTTGGTAAGCCAATGGCTGTAACTACATTACAAAATTTTATGAGCATGATT
AACTCTTGCCCTGCTAATTCTAATTTAAATGCTAACCCTTCTTGTTATTATGATCAAGGTAGAGGAATGG
TTATTAAAATAGGTGGACAAGTCATTAAAAATCGTGATCAAAGCTTTGTTAATAATGATAATACACAGAA
TGGTTTTATGTATTATCAAGCAACTAGCGGTGGTGCTATGGATTTTAGTAGCGATTGGCAGCCTACCGGT
ATGTTTAATAATTCTTTTTCAATGAGTGATTGGAGTAGAAATTTTTCTAATTATACTGATTTTGCAACTT
ATATAACTAATGGTAATTGGGCAACTAATTTTTTATATTTTGGTCGTTATGCAATGATTGTTGAGATAGG
TAATGGTACAAACACCATTAGCCCAGGTGATCAAAAAAATATAACTTTAGAGTATTTAATAACAGCTGAT
GGTACATTACCTAGTTCATCTACTCCCGGCACTACAGTCGGTTATGATTTTTCAGGTGATGCACCACAAG
ATGGATATTTATGGTTAAGAGTAAAAAATCCTAACAGTAATATACAGGGAACAATTAGTGTAGATTATGC
TAATTATACTGGTACAACTTGGTTTTCAAATATAGTTTATAATGGGGCAATTAAACCTATTACAGATCAA
TTTAGAACTTATAGTGAGGATTTTTATTTTAAGTTAGTTGCAAATTCTGCAATACAAAATATAGCTAAAA
CTGCATTAACGCTTTACGTTACTATATTTGGTTTAATGTTTGTTTTGGGGGCTTTAAAATTAACTGCTGT
AGAAGTAGTAACTCGTATATTTAAAATAACTATAGTAGCTATTTTACTTAGACCTGAAAGCTGGAGTTTC
TTTAATAACAATTTCTTTAGTGCATTTATTAATGGTATAGATTTCTTTGCAACGAATGTTGTAGGTGCTA
CAAGCTCTAAATCTAATATTTTTGGTTTTATTGATCCTATATTTGACAAATATACTAATGGTAGGATTTG
GGGATTACTGTTTATTCAGCTATTGCAAATACATAATGGTTTAGCATTTATTGTTATTATAACCATTTAC
TCACTTATTACTTATTTTAGAGCAGTACTTGAAGTAATTATAGGTTATGTTATAGCCTTTATAGGCTTGA
CAGTTATGATTTCATTAGCACCATTTTTTATAATATTAATGTTGTTTGAAAAAACAAAAACTATGTTTAA
CAACTGGATATCAATTTTGTTTAGCTATGTAGTGCAGCCAACGATATTATTAATTTTCTTTTTATTAATA
GATCAAATTTTATCAGAACAGCTGTTAAAGGTAATTGTCAGAGCTTGCTGGGATACACTCATACCGATTA
AAATAGGGCTCGATTTGTCAAATCTTGGTATTCCGTTAAATTTCTCTTTTACTTTACCATTTTTACCAGG
AATACCTTTTTTTGTTCCACAAGTTCCAGATATTACTAGTTCTAACATTTTAACGAATGACACTAATACA
TTTTTAGTATTGTTCACTACAGCTTTATTATTTTATTCATATTGTCTAATGTCGTATGGTTTAGTAAGTT
TTGTAACTATAGTTGTTGGTATGTTAACGCAGGTTACTCCTGCACGAATAGAAGGTAATTATCAAGCTCC
TTCTAATCCTACAGAATCTATTATGAAAGATATAGGTTCAGTAGCAGCCCCGATTAAAAAAGCTGCCCTT
GCTCCAGCACGGATTTTTAAAGATAAAGTAATTGATCAGAATTATGAAGCTAGAAAGCCGCAAGGTGGTG
GGGAGCATACAGGTAAGTTTTTTCAAAATCGTAATGATGTGAAACCTGAGCAGACGGAAAGGAACGATTA
G
 Primer design

Protein ID: 91206078
T4SS name [ID]VirB [492]
Gene symbolvirB6-3
Locus tagRBE_1263
StrainRickettsia bellii RML369-C
Repliconchromosome [GenBank: NC_007940] [Browse all T4SS(s) in this replicon]
Location [Strand]1358033..1360900 [-]
ProductVirB6
Component typeVirB6
UniProt IDQ1RH20
KEGG IDrbe:RBE_1263
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 9.7e-35, Aligned region: 601..840
Protein Sequence: 955 a.a.     [Download]
>gi|91206078|ref|YP_538433.1| VirB6 [Rickettsia bellii RML369-C]
MQSSLIKILGVLAIVATLVCFVFAALGMIGAVSVGNGCYMRYAPGGKGGSDSITSTITLNANANYVNTST
MLPDGTMQLTPDPAHYGEWLNTQVEVKDKQAVSLQVVGQISLCLAYVPKDNLQFTESTRPGKSNLDDNGK
MIPIPRVTDVNKPPLSLIMDAKNNEWRNITEMYANDRILVSVTPNYSPGAGGTVGAMDAFKGTNVTADCS
QGKTAYDPICGRYSIYSGPYVNACELKQNYWQGNKKQKCPNGCVWGTIDWCYTAPSAWCTYYYVCDSLSA
WVNNYGTMPEPYKDDGTFTFSWASNSGGIFIDYANLQCSNNINIPPNGKCPDSVDDRSPKDKDYIGGAGC
TSGVCNGGEFQSQRRFWYTSDGNGGKGPTGLIWQISNTSNVDSTLPSTLQFAQFVTASDQPTEYGNEYKV
IYNIPFNSNTDKGYLQYRLWCPTSQDASKNTGGYVMNIKQTKCYRENGNSLTDVFNNRGQVQYLVVPSAE
NPNTSGKNYSPEAAIVDSKGKANFNAAGEGYIWMRVLNDPNDYKDSEGSYKVHFSTSQSVGSFTIKVMNP
LLQLFKGKVKGAAESIFRNIVCYGGDTSSCTNFFNYIKALLILYVMVYGAMFLLGFAKINQKDLVVRIVK
IGIVSGLMNGNTFEFFNNYLFDTIANFSDEIISNMSGYSLFNSNGTVSNPFMFLDAVMSRILFSQTFMAQ
LLALLSLGLSGIIYFIITVIAVMIVIITAFRAAAVYIMAFMATCILIGIAPIFISFLLFDFTRYLFDNWV
RFTIRYMIEPVVLMAGIIVLTQLFTIYLDFVLGYSVCWKCALPIKIPFIGTILPVALLNVPIFCINWFAP
WGMDYMSGMMGVNMQNIVALVIIAYGMYGYVEFSGNMVARLTSAAGPSATSMGGAMSGAAEQGALSQVGM
DEKTRKGITGRAKERLKQRNETLKQAEKTRKNAPKEEPPKAEIPK
 
Nucleotide Sequence: 2868 bp     [Download]
>gi|91204815|ref|NC_007940.1|:c1360900-1358033 Rickettsia bellii RML369-C chromosome, complete genome
ATGCAAAGTAGCTTAATAAAAATTTTAGGTGTGCTTGCTATAGTAGCAACCCTTGTTTGCTTCGTTTTTG
CAGCCCTTGGAATGATAGGAGCAGTAAGCGTTGGTAATGGTTGTTATATGAGGTATGCTCCAGGTGGTAA
AGGAGGTTCAGATTCTATAACTAGTACAATTACTCTTAACGCTAATGCTAATTATGTTAATACCTCTACA
ATGTTACCAGATGGTACTATGCAGCTTACTCCTGATCCTGCTCATTATGGTGAGTGGTTAAATACCCAAG
TAGAAGTAAAAGATAAGCAAGCAGTATCATTACAAGTAGTTGGTCAGATTAGTTTATGCCTTGCTTATGT
GCCGAAAGATAATTTGCAATTTACTGAAAGTACAAGACCAGGTAAGTCTAATTTAGACGATAATGGCAAG
ATGATTCCTATTCCTCGTGTTACAGATGTTAATAAACCGCCGCTTTCCTTGATAATGGATGCAAAAAATA
ATGAGTGGCGTAATATTACTGAAATGTATGCTAATGATAGAATATTAGTTTCGGTGACGCCTAATTATTC
TCCTGGGGCAGGTGGGACAGTAGGGGCTATGGATGCTTTTAAAGGTACTAACGTTACGGCTGATTGTTCA
CAAGGTAAAACTGCTTATGATCCGATTTGTGGAAGATACTCTATTTATTCAGGACCATATGTAAATGCTT
GTGAATTAAAGCAAAATTATTGGCAAGGTAATAAAAAGCAAAAATGTCCAAATGGTTGCGTTTGGGGAAC
GATAGATTGGTGTTACACGGCTCCCTCAGCTTGGTGTACTTATTATTATGTATGCGATTCCTTATCGGCT
TGGGTAAATAATTATGGAACGATGCCTGAACCTTATAAGGATGATGGCACTTTTACTTTTAGTTGGGCAA
GTAATTCTGGGGGTATATTTATTGATTATGCTAATCTTCAATGTTCTAATAATATTAATATTCCGCCAAA
CGGCAAATGTCCTGATAGTGTAGATGATCGTAGTCCTAAAGATAAAGATTATATAGGCGGAGCTGGGTGT
ACTTCAGGTGTATGTAATGGAGGGGAATTTCAGTCACAACGAAGATTTTGGTATACGTCAGATGGTAATG
GTGGTAAGGGTCCAACAGGCTTAATATGGCAAATAAGTAATACAAGTAACGTAGATTCAACCCTACCTTC
CACCCTACAATTTGCTCAATTTGTAACAGCTTCAGATCAACCTACCGAATATGGTAATGAATATAAAGTA
ATATATAATATACCATTTAATAGTAATACTGATAAAGGCTATTTACAGTATAGGCTCTGGTGTCCTACTT
CTCAGGATGCAAGTAAAAATACTGGTGGTTATGTTATGAACATCAAACAAACTAAATGCTATAGAGAAAA
TGGCAATAGTTTAACTGATGTTTTTAATAATCGTGGTCAGGTACAATATTTAGTAGTACCAAGTGCAGAA
AATCCAAATACTAGTGGTAAGAATTATTCGCCTGAAGCTGCTATAGTAGATAGTAAGGGTAAAGCTAATT
TTAATGCAGCTGGTGAAGGGTATATATGGATGAGAGTGCTAAACGATCCGAATGATTATAAAGATAGTGA
GGGTAGTTATAAAGTACATTTTTCAACTTCTCAGTCAGTAGGAAGCTTTACCATTAAAGTAATGAATCCT
CTACTTCAGTTATTTAAAGGTAAAGTTAAAGGAGCTGCTGAGTCTATTTTCCGAAATATAGTATGTTATG
GAGGAGATACGTCTTCTTGTACTAACTTTTTTAATTATATTAAAGCACTTCTAATTCTTTATGTTATGGT
TTACGGGGCAATGTTTTTACTGGGCTTTGCAAAAATAAACCAAAAAGATTTAGTAGTTAGAATAGTAAAA
ATAGGTATTGTTAGTGGACTTATGAATGGCAATACGTTTGAGTTTTTTAATAATTATCTATTTGATACTA
TTGCTAACTTTTCCGATGAAATTATTTCTAATATGAGCGGATATAGCTTATTTAATTCCAATGGTACTGT
TTCAAATCCTTTCATGTTTTTAGATGCCGTAATGAGTAGGATATTGTTTAGCCAAACATTTATGGCACAA
TTACTTGCATTATTATCTTTAGGTCTTAGCGGTATTATATATTTTATAATTACTGTTATTGCAGTAATGA
TTGTAATTATAACAGCATTTAGAGCAGCTGCCGTTTATATTATGGCATTTATGGCGACTTGTATATTAAT
TGGTATAGCACCTATATTTATTAGCTTCTTATTATTTGATTTTACTAGGTATTTATTTGATAATTGGGTT
AGATTTACAATTAGATATATGATTGAGCCGGTTGTTTTAATGGCGGGTATCATTGTGCTGACTCAATTAT
TTACGATATATTTAGATTTTGTTTTAGGTTATAGCGTTTGTTGGAAATGTGCACTACCTATAAAAATTCC
GTTTATCGGTACTATTTTACCTGTTGCATTACTTAATGTACCAATCTTTTGTATAAACTGGTTTGCACCT
TGGGGTATGGATTATATGTCGGGTATGATGGGTGTGAATATGCAAAATATAGTTGCATTAGTTATTATAG
CTTATGGTATGTATGGTTATGTTGAGTTTTCCGGTAATATGGTGGCAAGACTGACAAGTGCGGCTGGTCC
TTCAGCTACTAGTATGGGTGGAGCAATGTCAGGTGCTGCAGAGCAGGGAGCATTGAGCCAAGTAGGTATG
GATGAAAAAACAAGAAAAGGTATTACTGGTAGAGCAAAAGAACGATTAAAGCAACGTAATGAAACTTTAA
AGCAAGCTGAGAAAACTAGAAAAAATGCACCAAAAGAAGAGCCGCCTAAAGCGGAAATACCAAAATAA
 Primer design

Protein ID: 91206079
T4SS name [ID]VirB [492]
Gene symbolvirB6-2
Locus tagRBE_1264
StrainRickettsia bellii RML369-C
Repliconchromosome [GenBank: NC_007940] [Browse all T4SS(s) in this replicon]
Location [Strand]1360907..1362928 [-]
ProductVirB6
Component typeVirB6
UniProt IDQ1RH19
KEGG IDrbe:RBE_1264
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 6.7e-17, Aligned region: 405..495
Protein Sequence: 673 a.a.     [Download]
>gi|91206079|ref|YP_538434.1| VirB6 [Rickettsia bellii RML369-C]
MKIHNIIKIIIVVCLEGFALTSFAGFGDSCASLPTTTDGYLESDTAYGYIIRSIDMKAPGGNCDANKPGI
TFCFKNKDGSSDPCTMYTLNQGDSKKISDLSKDNNPDLGANPILKNIVLTVQTWQNDICLLMPTSRGPMP
VACKALSNPPAPPSVPSCSNIGQSCYTGANYSQSLINFSGLAVQCLKETLDKIFFVGNSCGSQSQSSEIT
NLTAFPTFQGYLKNAIGAALILYVMFFAFNMVLNKEYGNPDKIALFVIKLLFVTYFSIGLGPLNFNSSQP
TQENGMLKYGLPLLTGIAPEFAQIIFNAAGSKGLCVFDTSKYQSGYQFYALWDSIDCRIGYYLGLDLLYN
IDKNGVLSSFARGDGGNSSGSIPIPNLGNPDKNSPNALTSVGSLRFFTVMFGFFMAGNVIILISGLVFAV
IFLSILLYFITHYLVCMITIYVMTYVSPIFIPMMLFNRTKGYFDGWLKVSLSCALQPAVVAGFIALLITM
YDSAIFKNCEFLRYDYEKNNVKFSTFELRLPASSAEVCQESFGYKMLNYYAGKGWEEHLVILFPIKSIAK
DVVSILAELLCVLVFSVIFYYFSKSISQFAADLTNGPKMDAVTASPTKIVDLVKQGAAFIKDAAQATQGK
PPSSGDMPGDGGSKRSEGQKGDDSFISSGGNSSGDSLSSSGGK
 
Nucleotide Sequence: 2022 bp     [Download]
>gi|91204815|ref|NC_007940.1|:c1362928-1360907 Rickettsia bellii RML369-C chromosome, complete genome
ATGAAAATCCATAATATTATAAAAATTATTATTGTCGTTTGTTTGGAAGGTTTTGCTTTAACTAGTTTTG
CCGGCTTTGGAGATTCTTGTGCCTCGTTGCCAACTACTACAGATGGGTATTTAGAATCTGATACGGCATA
TGGTTACATAATTCGTAGTATTGATATGAAAGCACCCGGAGGAAATTGTGATGCAAACAAGCCGGGTATA
ACTTTTTGCTTTAAGAATAAAGATGGTAGTAGTGACCCTTGTACTATGTATACTTTAAATCAAGGTGATT
CTAAAAAAATTAGCGATTTAAGCAAGGATAATAATCCTGATCTTGGTGCAAATCCTATATTAAAAAATAT
AGTCCTAACAGTACAAACATGGCAAAATGATATATGTTTGCTTATGCCAACGTCAAGAGGACCAATGCCG
GTGGCATGTAAAGCATTAAGTAATCCTCCTGCTCCTCCTTCTGTTCCTAGCTGTAGTAATATAGGACAAA
GTTGCTATACTGGAGCAAATTATAGTCAATCATTAATTAATTTTTCTGGTCTTGCTGTCCAGTGTTTAAA
AGAAACTCTTGATAAAATATTTTTTGTAGGAAATAGTTGCGGTTCACAAAGTCAAAGTTCTGAAATAACT
AATCTTACTGCTTTCCCTACCTTTCAAGGATATTTAAAAAATGCTATTGGTGCTGCTCTGATTCTGTACG
TAATGTTTTTTGCATTTAATATGGTGCTTAATAAAGAATATGGCAACCCAGATAAAATAGCCCTTTTTGT
AATAAAACTTTTATTTGTTACTTATTTTTCTATAGGGCTTGGTCCTCTGAATTTTAATAGCAGTCAGCCA
ACTCAAGAGAATGGTATGTTAAAATATGGGTTACCTCTCTTAACAGGGATAGCACCGGAATTCGCACAAA
TTATTTTTAATGCTGCGGGTTCAAAAGGATTATGCGTATTTGATACTTCAAAATACCAAAGTGGATATCA
ATTTTATGCTTTATGGGATTCTATAGATTGCCGTATAGGTTATTATCTTGGTCTAGATTTGCTTTATAAT
ATAGATAAAAATGGCGTATTGAGCAGTTTTGCAAGAGGTGATGGTGGTAATAGTAGTGGCAGTATACCTA
TACCAAATCTCGGAAATCCTGATAAAAACAGTCCAAATGCTTTAACTTCAGTAGGATCTTTAAGGTTTTT
TACTGTTATGTTTGGTTTCTTTATGGCAGGAAACGTCATTATTCTTATAAGTGGTTTAGTATTTGCGGTA
ATATTCCTTTCTATACTTTTATATTTTATCACACATTATTTAGTTTGTATGATTACTATTTATGTGATGA
CATATGTGTCACCAATATTTATTCCTATGATGTTATTTAATCGTACAAAGGGTTATTTCGATGGATGGTT
GAAAGTATCATTGTCATGTGCATTACAACCAGCTGTAGTAGCAGGCTTTATAGCTTTATTAATTACCATG
TATGATTCAGCAATATTTAAAAATTGTGAGTTCTTAAGGTATGATTACGAAAAAAATAATGTAAAATTTA
GTACTTTTGAATTAAGGTTGCCAGCTAGTAGTGCAGAGGTGTGTCAAGAAAGCTTTGGATATAAAATGCT
AAATTATTATGCTGGTAAAGGTTGGGAAGAACATTTAGTCATACTTTTCCCTATAAAATCAATTGCTAAA
GATGTTGTGTCCATTCTTGCTGAGCTGTTGTGCGTTTTGGTATTTTCGGTAATTTTTTATTATTTCTCTA
AATCGATAAGTCAATTTGCTGCTGATTTAACTAATGGTCCAAAAATGGATGCGGTAACAGCAAGCCCAAC
TAAAATCGTTGATTTAGTAAAGCAAGGGGCAGCTTTTATTAAAGATGCCGCACAAGCAACGCAAGGTAAA
CCTCCGAGCAGTGGTGATATGCCGGGCGATGGAGGAAGTAAACGTTCAGAAGGACAAAAAGGTGATGATT
CATTTATCTCAAGCGGAGGAAATAGCAGCGGAGATTCACTATCATCGAGTGGAGGTAAATAA
 Primer design

Protein ID: 91206080
T4SS name [ID]VirB [492]
Gene symbolvirB6-1
Locus tagRBE_1265
StrainRickettsia bellii RML369-C
Repliconchromosome [GenBank: NC_007940] [Browse all T4SS(s) in this replicon]
Location [Strand]1362915..1366034 [-]
ProductVirB6
Component typeVirB6
UniProt IDQ1RH18
KEGG IDrbe:RBE_1265
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.9e-12, Aligned region: 501..579
Protein Sequence: 1039 a.a.     [Download]
>gi|91206080|ref|YP_538435.1| VirB6 [Rickettsia bellii RML369-C]
MKLFPRTLLKILVVSFILNFGVTSKSYADDTLDTIVNTLQNLTCETQGVGDLLRTEFSQTCIVAPFFTFA
IMNLVSPVLYMNTFLKLRINDNELFGTQFPGGQCTRENRADPNDLKLTFGLCSNLKLAGVRAKAVVDSAL
AIAKAVLTGNDPWDDIKEAWKNNKADYYNIYTQKPEDSGTMWDLGVPIFWKVVQDNDRICVGTYGFTGVV
PVGCKYIKEPFPKSMYNSFMDVNDTNFIDDPNNKAVDPLALVSCSAAGGGCYQKAYNASRTAVVMTSPLI
ECIRQMIARLLISEDVCSFDDVNAVVNSASRQTSALFQFQVGMYRIVTAFLTLYVMLFGAKILLAGQVPP
KNEYINFILKIIFVTYFSIGLNITPGSTSPYDRMDGMIQWAFPFLLNGINGLASWVMNAAPSGLCKFNGP
DISYDNSVAYIALWDALDCRVAHYLGLDMLSTLLVENTYKSHNFANFDFFSFSAPPYIYLLIPAIISGNM
MLVSLALAYPLLVISVAAFMVNATVMCMVSIVILGILAPLFVPMFLFDYTRGYFDSWVKLMISFLLQPMV
VVTFMITMFSVYDFGFYGKCQYQSKLIHNSIEGALQGQTFKRDVLVFFVDNDWTKYSKEDAESCQNSLGY
MLNNPISTAFNFAKDSVEQIVGSKPNQTCDPKAADADTKCNPKPGDSSTSSFLSKFQFLSGVILGPGMFF
VSPKLLFEKIKDILLALVTACFTLYLMYNFSSQLANFAADMTEGVALSSVAIKPQAVFKAAMAALAAAGN
ATKGLDQFATKGGGGGDLLSTKGGRAGDLVKGSGGGGGSEGGDSFTSGGLRETSSTAATPSSALSSVGKS
VGGTATPSSASEEMLDTSFSNRKPIEAPVSQPTTVSTQIDTAIKTEPPKVSAAEVVRNTAEDKLEDLSSK
LNVTKEIKEAVPESQKEEPKEPRVKHTTEVEPELNLDENLGVTRTIRGLDKDRKFTEQESHELKIGEAGY
VKQEMRNAQIRDRRAAFEKETEELYRSVGGRAKDKATERNDGTIENRSKKIDSGSDENP
 
Nucleotide Sequence: 3120 bp     [Download]
>gi|91204815|ref|NC_007940.1|:c1366034-1362915 Rickettsia bellii RML369-C chromosome, complete genome
ATGAAATTATTTCCTCGTACTTTACTTAAAATTCTAGTGGTCAGTTTTATCCTCAATTTTGGGGTTACAA
GCAAGTCATATGCCGATGATACCCTCGATACTATTGTTAATACACTACAGAATTTAACTTGTGAAACACA
AGGAGTCGGTGACTTATTACGTACCGAATTTTCTCAAACCTGTATTGTCGCTCCATTTTTTACTTTTGCT
ATAATGAATCTTGTATCTCCTGTTTTATACATGAATACATTCTTAAAGCTTAGAATAAATGACAATGAAT
TATTTGGTACACAATTTCCGGGAGGGCAATGTACGCGTGAAAACAGAGCTGACCCAAATGATCTTAAATT
AACTTTTGGTTTATGTAGTAATTTAAAACTGGCAGGGGTAAGAGCAAAAGCAGTTGTAGATTCAGCACTT
GCTATTGCTAAGGCTGTATTAACCGGCAATGATCCATGGGATGATATAAAGGAAGCTTGGAAAAACAATA
AAGCAGATTATTATAATATATATACCCAAAAACCAGAAGATAGCGGTACAATGTGGGATTTAGGGGTACC
AATTTTTTGGAAAGTTGTTCAAGATAATGATCGTATATGTGTTGGGACATATGGTTTTACGGGTGTAGTA
CCAGTAGGATGTAAATATATAAAAGAGCCATTTCCAAAATCTATGTATAATAGCTTTATGGATGTAAACG
ATACAAATTTTATTGACGATCCTAATAATAAAGCTGTTGATCCTTTAGCATTGGTTTCTTGTAGTGCAGC
AGGTGGAGGTTGCTATCAAAAAGCTTATAACGCTTCAAGAACTGCAGTAGTTATGACTTCTCCGCTTATA
GAATGCATAAGACAAATGATCGCAAGATTATTGATTAGTGAAGATGTATGTAGCTTTGATGATGTAAACG
CAGTAGTTAATTCAGCTTCAAGGCAGACTAGTGCTTTATTCCAGTTTCAAGTAGGAATGTATAGAATAGT
TACGGCTTTCTTAACTTTATATGTTATGCTTTTTGGTGCTAAAATACTTCTTGCAGGTCAAGTTCCCCCA
AAAAATGAGTATATAAACTTTATATTAAAAATAATATTTGTAACTTATTTTTCAATAGGATTAAACATAA
CACCAGGTAGTACTTCCCCTTATGATCGTATGGATGGGATGATTCAATGGGCATTTCCTTTCTTGCTTAA
TGGTATAAACGGATTAGCAAGTTGGGTTATGAATGCTGCCCCATCTGGGTTATGTAAATTTAATGGTCCG
GATATTTCATATGACAATAGTGTTGCATATATTGCATTATGGGATGCTTTAGATTGTCGGGTAGCCCATT
ATTTGGGGCTAGATATGTTATCTACACTATTAGTTGAGAATACTTATAAAAGCCATAATTTTGCAAATTT
CGACTTTTTTAGCTTTAGTGCTCCTCCATATATTTACTTACTAATACCCGCTATAATATCTGGCAATATG
ATGCTAGTATCTCTAGCTCTTGCCTATCCGTTGCTTGTGATCTCAGTGGCTGCCTTTATGGTTAATGCCA
CCGTTATGTGCATGGTATCTATAGTAATACTTGGTATTTTAGCCCCTCTTTTCGTGCCAATGTTTTTATT
TGACTATACACGAGGCTATTTTGATAGCTGGGTTAAGCTAATGATTTCGTTTTTACTTCAGCCTATGGTA
GTAGTTACTTTTATGATTACTATGTTTTCGGTTTATGATTTTGGTTTTTACGGAAAATGCCAATATCAAA
GTAAATTGATTCATAATAGTATAGAGGGTGCCTTACAGGGACAAACTTTTAAAAGGGATGTTTTAGTATT
TTTTGTTGATAATGATTGGACAAAATATAGTAAAGAAGATGCAGAAAGTTGTCAAAATAGCTTAGGCTAT
ATGTTAAATAATCCGATTTCAACAGCTTTTAACTTTGCCAAAGACAGTGTAGAACAAATAGTTGGCAGTA
AGCCAAACCAGACTTGCGATCCAAAGGCAGCCGATGCAGATACTAAATGTAATCCAAAACCTGGAGATAG
TAGTACAAGTAGTTTCCTCTCTAAATTCCAGTTTTTATCAGGAGTAATTTTAGGTCCGGGAATGTTCTTT
GTTTCTCCTAAATTACTTTTTGAGAAGATTAAAGATATTTTACTTGCTCTAGTTACAGCCTGTTTTACCT
TATATTTAATGTATAATTTTAGCAGCCAGCTAGCTAATTTTGCAGCAGATATGACGGAAGGGGTAGCTCT
TAGCAGCGTTGCCATAAAACCGCAAGCGGTATTTAAAGCCGCAATGGCTGCACTTGCCGCTGCAGGTAAT
GCAACCAAAGGTCTTGACCAATTCGCTACCAAAGGTGGAGGTGGTGGTGATTTACTCAGCACTAAAGGTG
GAAGAGCCGGTGATTTAGTAAAAGGTAGCGGCGGTGGCGGTGGTAGTGAAGGAGGTGATTCTTTCACATC
AGGTGGTCTTAGAGAAACGTCTAGTACGGCTGCAACTCCATCTTCTGCACTAAGTTCTGTTGGTAAAAGT
GTAGGCGGCACAGCAACACCAAGTAGTGCTTCTGAAGAAATGCTTGATACTAGCTTTAGTAATAGAAAAC
CTATAGAAGCACCTGTGTCTCAACCAACGACAGTTTCAACGCAAATTGATACTGCTATTAAAACTGAGCC
ACCGAAAGTAAGTGCAGCAGAAGTTGTAAGAAATACTGCAGAAGATAAGCTTGAAGATTTATCAAGTAAG
CTTAATGTTACAAAAGAAATTAAAGAAGCTGTACCTGAATCTCAGAAAGAAGAACCAAAAGAGCCAAGAG
TAAAACATACTACTGAGGTGGAACCGGAACTTAATTTAGACGAAAACCTTGGAGTTACACGTACTATCAG
AGGGCTTGATAAGGACAGAAAATTTACCGAACAAGAAAGTCACGAATTAAAGATAGGTGAGGCAGGATAC
GTAAAGCAAGAGATGAGAAATGCTCAAATTCGTGATAGAAGAGCAGCATTTGAAAAAGAAACGGAGGAAT
TATATCGTAGTGTGGGTGGTAGAGCAAAAGATAAAGCGACCGAGCGAAATGATGGAACGATTGAAAATAG
AAGCAAGAAAATAGATAGTGGTTCCGATGAAAATCCATAA
 Primer design