SecReT4
Protein ID: 91206077
T4SS name [ID]VirB [492]
Gene symbolvirB6-4
Locus tagRBE_1262
StrainRickettsia bellii RML369-C
Repliconchromosome [GenBank: NC_007940] [Browse all T4SS(s) in this replicon]
Location [Strand]1355366..1358026 [-]
ProductVirB6
Component typeVirB6
UniProt IDQ1RH21
KEGG IDrbe:RBE_1262
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.4e-19, Aligned region: 516..711
Protein Sequence: 886 a.a.     [Download]
>gi|91206077|ref|YP_538432.1| VirB6 [Rickettsia bellii RML369-C]
MKIIKSLILLVLFMASPAKGDDFAWMSSGLSGLKSIFGCLEVPTFTSFQEGKIGISLSTAGDWQSTGNAV
EKGKLLKIKWSTAGLTPEPRKYLVLYRIDPRFSVPQVFIKTYNYKNSQFEVAGFPGFSTANDGVIPPDKN
LDALSFTKMNNYVNYFNYANGNPKIQVNVGDIVNISLADKDDFFNPSTSKTPSTLNNILAKELDSSVFAA
SALYTESNLGNFENRIVYSSAEQVCNIIDAQRATLCTGTGSATKYTNVSNGALVGKPMAVTTLQNFMSMI
NSCPANSNLNANPSCYYDQGRGMVIKIGGQVIKNRDQSFVNNDNTQNGFMYYQATSGGAMDFSSDWQPTG
MFNNSFSMSDWSRNFSNYTDFATYITNGNWATNFLYFGRYAMIVEIGNGTNTISPGDQKNITLEYLITAD
GTLPSSSTPGTTVGYDFSGDAPQDGYLWLRVKNPNSNIQGTISVDYANYTGTTWFSNIVYNGAIKPITDQ
FRTYSEDFYFKLVANSAIQNIAKTALTLYVTIFGLMFVLGALKLTAVEVVTRIFKITIVAILLRPESWSF
FNNNFFSAFINGIDFFATNVVGATSSKSNIFGFIDPIFDKYTNGRIWGLLFIQLLQIHNGLAFIVIITIY
SLITYFRAVLEVIIGYVIAFIGLTVMISLAPFFIILMLFEKTKTMFNNWISILFSYVVQPTILLIFFLLI
DQILSEQLLKVIVRACWDTLIPIKIGLDLSNLGIPLNFSFTLPFLPGIPFFVPQVPDITSSNILTNDTNT
FLVLFTTALLFYSYCLMSYGLVSFVTIVVGMLTQVTPARIEGNYQAPSNPTESIMKDIGSVAAPIKKAAL
APARIFKDKVIDQNYEARKPQGGGEHTGKFFQNRNDVKPEQTERND
 
Nucleotide Sequence: 2661 bp     [Download]
>gi|91204815|ref|NC_007940.1|:c1358026-1355366 Rickettsia bellii RML369-C chromosome, complete genome
ATGAAAATTATTAAAAGTTTAATTTTATTAGTTTTATTTATGGCGTCGCCTGCCAAAGGTGATGACTTTG
CTTGGATGTCAAGTGGGCTTAGCGGTCTTAAAAGCATTTTTGGTTGTTTAGAAGTACCTACATTTACAAG
TTTCCAAGAGGGTAAAATAGGTATTAGTTTATCGACTGCTGGAGATTGGCAATCAACAGGTAATGCAGTT
GAAAAAGGTAAGCTGCTTAAGATTAAATGGTCTACTGCAGGTCTTACCCCAGAGCCTCGAAAATATCTAG
TATTATATAGAATTGACCCAAGGTTTAGTGTTCCGCAAGTCTTTATAAAAACTTATAATTACAAAAACTC
ACAGTTTGAAGTTGCAGGATTCCCAGGTTTTAGTACAGCAAATGATGGTGTTATACCTCCTGATAAAAAC
CTTGATGCATTATCATTTACTAAGATGAATAATTATGTTAACTACTTTAATTATGCTAATGGTAATCCAA
AAATTCAGGTTAATGTTGGTGATATAGTAAATATTAGTCTAGCTGATAAAGATGATTTTTTTAATCCAAG
TACATCAAAAACTCCAAGCACCTTAAATAATATACTAGCTAAAGAACTCGATAGTTCTGTATTTGCTGCT
TCTGCTCTTTATACTGAAAGCAATCTTGGTAATTTTGAAAATAGGATAGTTTACTCAAGTGCAGAGCAAG
TTTGTAATATTATAGATGCTCAAAGAGCAACTTTATGTACTGGTACAGGTTCGGCTACAAAATATACTAA
TGTTAGTAATGGTGCATTAGTTGGTAAGCCAATGGCTGTAACTACATTACAAAATTTTATGAGCATGATT
AACTCTTGCCCTGCTAATTCTAATTTAAATGCTAACCCTTCTTGTTATTATGATCAAGGTAGAGGAATGG
TTATTAAAATAGGTGGACAAGTCATTAAAAATCGTGATCAAAGCTTTGTTAATAATGATAATACACAGAA
TGGTTTTATGTATTATCAAGCAACTAGCGGTGGTGCTATGGATTTTAGTAGCGATTGGCAGCCTACCGGT
ATGTTTAATAATTCTTTTTCAATGAGTGATTGGAGTAGAAATTTTTCTAATTATACTGATTTTGCAACTT
ATATAACTAATGGTAATTGGGCAACTAATTTTTTATATTTTGGTCGTTATGCAATGATTGTTGAGATAGG
TAATGGTACAAACACCATTAGCCCAGGTGATCAAAAAAATATAACTTTAGAGTATTTAATAACAGCTGAT
GGTACATTACCTAGTTCATCTACTCCCGGCACTACAGTCGGTTATGATTTTTCAGGTGATGCACCACAAG
ATGGATATTTATGGTTAAGAGTAAAAAATCCTAACAGTAATATACAGGGAACAATTAGTGTAGATTATGC
TAATTATACTGGTACAACTTGGTTTTCAAATATAGTTTATAATGGGGCAATTAAACCTATTACAGATCAA
TTTAGAACTTATAGTGAGGATTTTTATTTTAAGTTAGTTGCAAATTCTGCAATACAAAATATAGCTAAAA
CTGCATTAACGCTTTACGTTACTATATTTGGTTTAATGTTTGTTTTGGGGGCTTTAAAATTAACTGCTGT
AGAAGTAGTAACTCGTATATTTAAAATAACTATAGTAGCTATTTTACTTAGACCTGAAAGCTGGAGTTTC
TTTAATAACAATTTCTTTAGTGCATTTATTAATGGTATAGATTTCTTTGCAACGAATGTTGTAGGTGCTA
CAAGCTCTAAATCTAATATTTTTGGTTTTATTGATCCTATATTTGACAAATATACTAATGGTAGGATTTG
GGGATTACTGTTTATTCAGCTATTGCAAATACATAATGGTTTAGCATTTATTGTTATTATAACCATTTAC
TCACTTATTACTTATTTTAGAGCAGTACTTGAAGTAATTATAGGTTATGTTATAGCCTTTATAGGCTTGA
CAGTTATGATTTCATTAGCACCATTTTTTATAATATTAATGTTGTTTGAAAAAACAAAAACTATGTTTAA
CAACTGGATATCAATTTTGTTTAGCTATGTAGTGCAGCCAACGATATTATTAATTTTCTTTTTATTAATA
GATCAAATTTTATCAGAACAGCTGTTAAAGGTAATTGTCAGAGCTTGCTGGGATACACTCATACCGATTA
AAATAGGGCTCGATTTGTCAAATCTTGGTATTCCGTTAAATTTCTCTTTTACTTTACCATTTTTACCAGG
AATACCTTTTTTTGTTCCACAAGTTCCAGATATTACTAGTTCTAACATTTTAACGAATGACACTAATACA
TTTTTAGTATTGTTCACTACAGCTTTATTATTTTATTCATATTGTCTAATGTCGTATGGTTTAGTAAGTT
TTGTAACTATAGTTGTTGGTATGTTAACGCAGGTTACTCCTGCACGAATAGAAGGTAATTATCAAGCTCC
TTCTAATCCTACAGAATCTATTATGAAAGATATAGGTTCAGTAGCAGCCCCGATTAAAAAAGCTGCCCTT
GCTCCAGCACGGATTTTTAAAGATAAAGTAATTGATCAGAATTATGAAGCTAGAAAGCCGCAAGGTGGTG
GGGAGCATACAGGTAAGTTTTTTCAAAATCGTAATGATGTGAAACCTGAGCAGACGGAAAGGAACGATTA
G
 Primer design