SecReT4
Protein ID: 91206078
T4SS name [ID]VirB [492]
Gene symbolvirB6-3
Locus tagRBE_1263
StrainRickettsia bellii RML369-C
Repliconchromosome [GenBank: NC_007940] [Browse all T4SS(s) in this replicon]
Location [Strand]1358033..1360900 [-]
ProductVirB6
Component typeVirB6
UniProt IDQ1RH20
KEGG IDrbe:RBE_1263
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 9.7e-35, Aligned region: 601..840
Protein Sequence: 955 a.a.     [Download]
>gi|91206078|ref|YP_538433.1| VirB6 [Rickettsia bellii RML369-C]
MQSSLIKILGVLAIVATLVCFVFAALGMIGAVSVGNGCYMRYAPGGKGGSDSITSTITLNANANYVNTST
MLPDGTMQLTPDPAHYGEWLNTQVEVKDKQAVSLQVVGQISLCLAYVPKDNLQFTESTRPGKSNLDDNGK
MIPIPRVTDVNKPPLSLIMDAKNNEWRNITEMYANDRILVSVTPNYSPGAGGTVGAMDAFKGTNVTADCS
QGKTAYDPICGRYSIYSGPYVNACELKQNYWQGNKKQKCPNGCVWGTIDWCYTAPSAWCTYYYVCDSLSA
WVNNYGTMPEPYKDDGTFTFSWASNSGGIFIDYANLQCSNNINIPPNGKCPDSVDDRSPKDKDYIGGAGC
TSGVCNGGEFQSQRRFWYTSDGNGGKGPTGLIWQISNTSNVDSTLPSTLQFAQFVTASDQPTEYGNEYKV
IYNIPFNSNTDKGYLQYRLWCPTSQDASKNTGGYVMNIKQTKCYRENGNSLTDVFNNRGQVQYLVVPSAE
NPNTSGKNYSPEAAIVDSKGKANFNAAGEGYIWMRVLNDPNDYKDSEGSYKVHFSTSQSVGSFTIKVMNP
LLQLFKGKVKGAAESIFRNIVCYGGDTSSCTNFFNYIKALLILYVMVYGAMFLLGFAKINQKDLVVRIVK
IGIVSGLMNGNTFEFFNNYLFDTIANFSDEIISNMSGYSLFNSNGTVSNPFMFLDAVMSRILFSQTFMAQ
LLALLSLGLSGIIYFIITVIAVMIVIITAFRAAAVYIMAFMATCILIGIAPIFISFLLFDFTRYLFDNWV
RFTIRYMIEPVVLMAGIIVLTQLFTIYLDFVLGYSVCWKCALPIKIPFIGTILPVALLNVPIFCINWFAP
WGMDYMSGMMGVNMQNIVALVIIAYGMYGYVEFSGNMVARLTSAAGPSATSMGGAMSGAAEQGALSQVGM
DEKTRKGITGRAKERLKQRNETLKQAEKTRKNAPKEEPPKAEIPK
 
Nucleotide Sequence: 2868 bp     [Download]
>gi|91204815|ref|NC_007940.1|:c1360900-1358033 Rickettsia bellii RML369-C chromosome, complete genome
ATGCAAAGTAGCTTAATAAAAATTTTAGGTGTGCTTGCTATAGTAGCAACCCTTGTTTGCTTCGTTTTTG
CAGCCCTTGGAATGATAGGAGCAGTAAGCGTTGGTAATGGTTGTTATATGAGGTATGCTCCAGGTGGTAA
AGGAGGTTCAGATTCTATAACTAGTACAATTACTCTTAACGCTAATGCTAATTATGTTAATACCTCTACA
ATGTTACCAGATGGTACTATGCAGCTTACTCCTGATCCTGCTCATTATGGTGAGTGGTTAAATACCCAAG
TAGAAGTAAAAGATAAGCAAGCAGTATCATTACAAGTAGTTGGTCAGATTAGTTTATGCCTTGCTTATGT
GCCGAAAGATAATTTGCAATTTACTGAAAGTACAAGACCAGGTAAGTCTAATTTAGACGATAATGGCAAG
ATGATTCCTATTCCTCGTGTTACAGATGTTAATAAACCGCCGCTTTCCTTGATAATGGATGCAAAAAATA
ATGAGTGGCGTAATATTACTGAAATGTATGCTAATGATAGAATATTAGTTTCGGTGACGCCTAATTATTC
TCCTGGGGCAGGTGGGACAGTAGGGGCTATGGATGCTTTTAAAGGTACTAACGTTACGGCTGATTGTTCA
CAAGGTAAAACTGCTTATGATCCGATTTGTGGAAGATACTCTATTTATTCAGGACCATATGTAAATGCTT
GTGAATTAAAGCAAAATTATTGGCAAGGTAATAAAAAGCAAAAATGTCCAAATGGTTGCGTTTGGGGAAC
GATAGATTGGTGTTACACGGCTCCCTCAGCTTGGTGTACTTATTATTATGTATGCGATTCCTTATCGGCT
TGGGTAAATAATTATGGAACGATGCCTGAACCTTATAAGGATGATGGCACTTTTACTTTTAGTTGGGCAA
GTAATTCTGGGGGTATATTTATTGATTATGCTAATCTTCAATGTTCTAATAATATTAATATTCCGCCAAA
CGGCAAATGTCCTGATAGTGTAGATGATCGTAGTCCTAAAGATAAAGATTATATAGGCGGAGCTGGGTGT
ACTTCAGGTGTATGTAATGGAGGGGAATTTCAGTCACAACGAAGATTTTGGTATACGTCAGATGGTAATG
GTGGTAAGGGTCCAACAGGCTTAATATGGCAAATAAGTAATACAAGTAACGTAGATTCAACCCTACCTTC
CACCCTACAATTTGCTCAATTTGTAACAGCTTCAGATCAACCTACCGAATATGGTAATGAATATAAAGTA
ATATATAATATACCATTTAATAGTAATACTGATAAAGGCTATTTACAGTATAGGCTCTGGTGTCCTACTT
CTCAGGATGCAAGTAAAAATACTGGTGGTTATGTTATGAACATCAAACAAACTAAATGCTATAGAGAAAA
TGGCAATAGTTTAACTGATGTTTTTAATAATCGTGGTCAGGTACAATATTTAGTAGTACCAAGTGCAGAA
AATCCAAATACTAGTGGTAAGAATTATTCGCCTGAAGCTGCTATAGTAGATAGTAAGGGTAAAGCTAATT
TTAATGCAGCTGGTGAAGGGTATATATGGATGAGAGTGCTAAACGATCCGAATGATTATAAAGATAGTGA
GGGTAGTTATAAAGTACATTTTTCAACTTCTCAGTCAGTAGGAAGCTTTACCATTAAAGTAATGAATCCT
CTACTTCAGTTATTTAAAGGTAAAGTTAAAGGAGCTGCTGAGTCTATTTTCCGAAATATAGTATGTTATG
GAGGAGATACGTCTTCTTGTACTAACTTTTTTAATTATATTAAAGCACTTCTAATTCTTTATGTTATGGT
TTACGGGGCAATGTTTTTACTGGGCTTTGCAAAAATAAACCAAAAAGATTTAGTAGTTAGAATAGTAAAA
ATAGGTATTGTTAGTGGACTTATGAATGGCAATACGTTTGAGTTTTTTAATAATTATCTATTTGATACTA
TTGCTAACTTTTCCGATGAAATTATTTCTAATATGAGCGGATATAGCTTATTTAATTCCAATGGTACTGT
TTCAAATCCTTTCATGTTTTTAGATGCCGTAATGAGTAGGATATTGTTTAGCCAAACATTTATGGCACAA
TTACTTGCATTATTATCTTTAGGTCTTAGCGGTATTATATATTTTATAATTACTGTTATTGCAGTAATGA
TTGTAATTATAACAGCATTTAGAGCAGCTGCCGTTTATATTATGGCATTTATGGCGACTTGTATATTAAT
TGGTATAGCACCTATATTTATTAGCTTCTTATTATTTGATTTTACTAGGTATTTATTTGATAATTGGGTT
AGATTTACAATTAGATATATGATTGAGCCGGTTGTTTTAATGGCGGGTATCATTGTGCTGACTCAATTAT
TTACGATATATTTAGATTTTGTTTTAGGTTATAGCGTTTGTTGGAAATGTGCACTACCTATAAAAATTCC
GTTTATCGGTACTATTTTACCTGTTGCATTACTTAATGTACCAATCTTTTGTATAAACTGGTTTGCACCT
TGGGGTATGGATTATATGTCGGGTATGATGGGTGTGAATATGCAAAATATAGTTGCATTAGTTATTATAG
CTTATGGTATGTATGGTTATGTTGAGTTTTCCGGTAATATGGTGGCAAGACTGACAAGTGCGGCTGGTCC
TTCAGCTACTAGTATGGGTGGAGCAATGTCAGGTGCTGCAGAGCAGGGAGCATTGAGCCAAGTAGGTATG
GATGAAAAAACAAGAAAAGGTATTACTGGTAGAGCAAAAGAACGATTAAAGCAACGTAATGAAACTTTAA
AGCAAGCTGAGAAAACTAGAAAAAATGCACCAAAAGAAGAGCCGCCTAAAGCGGAAATACCAAAATAA
 Primer design