SecReT4
Protein ID: 91206079
T4SS name [ID]VirB [492]
Gene symbolvirB6-2
Locus tagRBE_1264
StrainRickettsia bellii RML369-C
Repliconchromosome [GenBank: NC_007940] [Browse all T4SS(s) in this replicon]
Location [Strand]1360907..1362928 [-]
ProductVirB6
Component typeVirB6
UniProt IDQ1RH19
KEGG IDrbe:RBE_1264
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 6.7e-17, Aligned region: 405..495
Protein Sequence: 673 a.a.     [Download]
>gi|91206079|ref|YP_538434.1| VirB6 [Rickettsia bellii RML369-C]
MKIHNIIKIIIVVCLEGFALTSFAGFGDSCASLPTTTDGYLESDTAYGYIIRSIDMKAPGGNCDANKPGI
TFCFKNKDGSSDPCTMYTLNQGDSKKISDLSKDNNPDLGANPILKNIVLTVQTWQNDICLLMPTSRGPMP
VACKALSNPPAPPSVPSCSNIGQSCYTGANYSQSLINFSGLAVQCLKETLDKIFFVGNSCGSQSQSSEIT
NLTAFPTFQGYLKNAIGAALILYVMFFAFNMVLNKEYGNPDKIALFVIKLLFVTYFSIGLGPLNFNSSQP
TQENGMLKYGLPLLTGIAPEFAQIIFNAAGSKGLCVFDTSKYQSGYQFYALWDSIDCRIGYYLGLDLLYN
IDKNGVLSSFARGDGGNSSGSIPIPNLGNPDKNSPNALTSVGSLRFFTVMFGFFMAGNVIILISGLVFAV
IFLSILLYFITHYLVCMITIYVMTYVSPIFIPMMLFNRTKGYFDGWLKVSLSCALQPAVVAGFIALLITM
YDSAIFKNCEFLRYDYEKNNVKFSTFELRLPASSAEVCQESFGYKMLNYYAGKGWEEHLVILFPIKSIAK
DVVSILAELLCVLVFSVIFYYFSKSISQFAADLTNGPKMDAVTASPTKIVDLVKQGAAFIKDAAQATQGK
PPSSGDMPGDGGSKRSEGQKGDDSFISSGGNSSGDSLSSSGGK
 
Nucleotide Sequence: 2022 bp     [Download]
>gi|91204815|ref|NC_007940.1|:c1362928-1360907 Rickettsia bellii RML369-C chromosome, complete genome
ATGAAAATCCATAATATTATAAAAATTATTATTGTCGTTTGTTTGGAAGGTTTTGCTTTAACTAGTTTTG
CCGGCTTTGGAGATTCTTGTGCCTCGTTGCCAACTACTACAGATGGGTATTTAGAATCTGATACGGCATA
TGGTTACATAATTCGTAGTATTGATATGAAAGCACCCGGAGGAAATTGTGATGCAAACAAGCCGGGTATA
ACTTTTTGCTTTAAGAATAAAGATGGTAGTAGTGACCCTTGTACTATGTATACTTTAAATCAAGGTGATT
CTAAAAAAATTAGCGATTTAAGCAAGGATAATAATCCTGATCTTGGTGCAAATCCTATATTAAAAAATAT
AGTCCTAACAGTACAAACATGGCAAAATGATATATGTTTGCTTATGCCAACGTCAAGAGGACCAATGCCG
GTGGCATGTAAAGCATTAAGTAATCCTCCTGCTCCTCCTTCTGTTCCTAGCTGTAGTAATATAGGACAAA
GTTGCTATACTGGAGCAAATTATAGTCAATCATTAATTAATTTTTCTGGTCTTGCTGTCCAGTGTTTAAA
AGAAACTCTTGATAAAATATTTTTTGTAGGAAATAGTTGCGGTTCACAAAGTCAAAGTTCTGAAATAACT
AATCTTACTGCTTTCCCTACCTTTCAAGGATATTTAAAAAATGCTATTGGTGCTGCTCTGATTCTGTACG
TAATGTTTTTTGCATTTAATATGGTGCTTAATAAAGAATATGGCAACCCAGATAAAATAGCCCTTTTTGT
AATAAAACTTTTATTTGTTACTTATTTTTCTATAGGGCTTGGTCCTCTGAATTTTAATAGCAGTCAGCCA
ACTCAAGAGAATGGTATGTTAAAATATGGGTTACCTCTCTTAACAGGGATAGCACCGGAATTCGCACAAA
TTATTTTTAATGCTGCGGGTTCAAAAGGATTATGCGTATTTGATACTTCAAAATACCAAAGTGGATATCA
ATTTTATGCTTTATGGGATTCTATAGATTGCCGTATAGGTTATTATCTTGGTCTAGATTTGCTTTATAAT
ATAGATAAAAATGGCGTATTGAGCAGTTTTGCAAGAGGTGATGGTGGTAATAGTAGTGGCAGTATACCTA
TACCAAATCTCGGAAATCCTGATAAAAACAGTCCAAATGCTTTAACTTCAGTAGGATCTTTAAGGTTTTT
TACTGTTATGTTTGGTTTCTTTATGGCAGGAAACGTCATTATTCTTATAAGTGGTTTAGTATTTGCGGTA
ATATTCCTTTCTATACTTTTATATTTTATCACACATTATTTAGTTTGTATGATTACTATTTATGTGATGA
CATATGTGTCACCAATATTTATTCCTATGATGTTATTTAATCGTACAAAGGGTTATTTCGATGGATGGTT
GAAAGTATCATTGTCATGTGCATTACAACCAGCTGTAGTAGCAGGCTTTATAGCTTTATTAATTACCATG
TATGATTCAGCAATATTTAAAAATTGTGAGTTCTTAAGGTATGATTACGAAAAAAATAATGTAAAATTTA
GTACTTTTGAATTAAGGTTGCCAGCTAGTAGTGCAGAGGTGTGTCAAGAAAGCTTTGGATATAAAATGCT
AAATTATTATGCTGGTAAAGGTTGGGAAGAACATTTAGTCATACTTTTCCCTATAAAATCAATTGCTAAA
GATGTTGTGTCCATTCTTGCTGAGCTGTTGTGCGTTTTGGTATTTTCGGTAATTTTTTATTATTTCTCTA
AATCGATAAGTCAATTTGCTGCTGATTTAACTAATGGTCCAAAAATGGATGCGGTAACAGCAAGCCCAAC
TAAAATCGTTGATTTAGTAAAGCAAGGGGCAGCTTTTATTAAAGATGCCGCACAAGCAACGCAAGGTAAA
CCTCCGAGCAGTGGTGATATGCCGGGCGATGGAGGAAGTAAACGTTCAGAAGGACAAAAAGGTGATGATT
CATTTATCTCAAGCGGAGGAAATAGCAGCGGAGATTCACTATCATCGAGTGGAGGTAAATAA
 Primer design