SecReT4
Protein ID: 91206080
T4SS name [ID]VirB [492]
Gene symbolvirB6-1
Locus tagRBE_1265
StrainRickettsia bellii RML369-C
Repliconchromosome [GenBank: NC_007940] [Browse all T4SS(s) in this replicon]
Location [Strand]1362915..1366034 [-]
ProductVirB6
Component typeVirB6
UniProt IDQ1RH18
KEGG IDrbe:RBE_1265
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.9e-12, Aligned region: 501..579
Protein Sequence: 1039 a.a.     [Download]
>gi|91206080|ref|YP_538435.1| VirB6 [Rickettsia bellii RML369-C]
MKLFPRTLLKILVVSFILNFGVTSKSYADDTLDTIVNTLQNLTCETQGVGDLLRTEFSQTCIVAPFFTFA
IMNLVSPVLYMNTFLKLRINDNELFGTQFPGGQCTRENRADPNDLKLTFGLCSNLKLAGVRAKAVVDSAL
AIAKAVLTGNDPWDDIKEAWKNNKADYYNIYTQKPEDSGTMWDLGVPIFWKVVQDNDRICVGTYGFTGVV
PVGCKYIKEPFPKSMYNSFMDVNDTNFIDDPNNKAVDPLALVSCSAAGGGCYQKAYNASRTAVVMTSPLI
ECIRQMIARLLISEDVCSFDDVNAVVNSASRQTSALFQFQVGMYRIVTAFLTLYVMLFGAKILLAGQVPP
KNEYINFILKIIFVTYFSIGLNITPGSTSPYDRMDGMIQWAFPFLLNGINGLASWVMNAAPSGLCKFNGP
DISYDNSVAYIALWDALDCRVAHYLGLDMLSTLLVENTYKSHNFANFDFFSFSAPPYIYLLIPAIISGNM
MLVSLALAYPLLVISVAAFMVNATVMCMVSIVILGILAPLFVPMFLFDYTRGYFDSWVKLMISFLLQPMV
VVTFMITMFSVYDFGFYGKCQYQSKLIHNSIEGALQGQTFKRDVLVFFVDNDWTKYSKEDAESCQNSLGY
MLNNPISTAFNFAKDSVEQIVGSKPNQTCDPKAADADTKCNPKPGDSSTSSFLSKFQFLSGVILGPGMFF
VSPKLLFEKIKDILLALVTACFTLYLMYNFSSQLANFAADMTEGVALSSVAIKPQAVFKAAMAALAAAGN
ATKGLDQFATKGGGGGDLLSTKGGRAGDLVKGSGGGGGSEGGDSFTSGGLRETSSTAATPSSALSSVGKS
VGGTATPSSASEEMLDTSFSNRKPIEAPVSQPTTVSTQIDTAIKTEPPKVSAAEVVRNTAEDKLEDLSSK
LNVTKEIKEAVPESQKEEPKEPRVKHTTEVEPELNLDENLGVTRTIRGLDKDRKFTEQESHELKIGEAGY
VKQEMRNAQIRDRRAAFEKETEELYRSVGGRAKDKATERNDGTIENRSKKIDSGSDENP
 
Nucleotide Sequence: 3120 bp     [Download]
>gi|91204815|ref|NC_007940.1|:c1366034-1362915 Rickettsia bellii RML369-C chromosome, complete genome
ATGAAATTATTTCCTCGTACTTTACTTAAAATTCTAGTGGTCAGTTTTATCCTCAATTTTGGGGTTACAA
GCAAGTCATATGCCGATGATACCCTCGATACTATTGTTAATACACTACAGAATTTAACTTGTGAAACACA
AGGAGTCGGTGACTTATTACGTACCGAATTTTCTCAAACCTGTATTGTCGCTCCATTTTTTACTTTTGCT
ATAATGAATCTTGTATCTCCTGTTTTATACATGAATACATTCTTAAAGCTTAGAATAAATGACAATGAAT
TATTTGGTACACAATTTCCGGGAGGGCAATGTACGCGTGAAAACAGAGCTGACCCAAATGATCTTAAATT
AACTTTTGGTTTATGTAGTAATTTAAAACTGGCAGGGGTAAGAGCAAAAGCAGTTGTAGATTCAGCACTT
GCTATTGCTAAGGCTGTATTAACCGGCAATGATCCATGGGATGATATAAAGGAAGCTTGGAAAAACAATA
AAGCAGATTATTATAATATATATACCCAAAAACCAGAAGATAGCGGTACAATGTGGGATTTAGGGGTACC
AATTTTTTGGAAAGTTGTTCAAGATAATGATCGTATATGTGTTGGGACATATGGTTTTACGGGTGTAGTA
CCAGTAGGATGTAAATATATAAAAGAGCCATTTCCAAAATCTATGTATAATAGCTTTATGGATGTAAACG
ATACAAATTTTATTGACGATCCTAATAATAAAGCTGTTGATCCTTTAGCATTGGTTTCTTGTAGTGCAGC
AGGTGGAGGTTGCTATCAAAAAGCTTATAACGCTTCAAGAACTGCAGTAGTTATGACTTCTCCGCTTATA
GAATGCATAAGACAAATGATCGCAAGATTATTGATTAGTGAAGATGTATGTAGCTTTGATGATGTAAACG
CAGTAGTTAATTCAGCTTCAAGGCAGACTAGTGCTTTATTCCAGTTTCAAGTAGGAATGTATAGAATAGT
TACGGCTTTCTTAACTTTATATGTTATGCTTTTTGGTGCTAAAATACTTCTTGCAGGTCAAGTTCCCCCA
AAAAATGAGTATATAAACTTTATATTAAAAATAATATTTGTAACTTATTTTTCAATAGGATTAAACATAA
CACCAGGTAGTACTTCCCCTTATGATCGTATGGATGGGATGATTCAATGGGCATTTCCTTTCTTGCTTAA
TGGTATAAACGGATTAGCAAGTTGGGTTATGAATGCTGCCCCATCTGGGTTATGTAAATTTAATGGTCCG
GATATTTCATATGACAATAGTGTTGCATATATTGCATTATGGGATGCTTTAGATTGTCGGGTAGCCCATT
ATTTGGGGCTAGATATGTTATCTACACTATTAGTTGAGAATACTTATAAAAGCCATAATTTTGCAAATTT
CGACTTTTTTAGCTTTAGTGCTCCTCCATATATTTACTTACTAATACCCGCTATAATATCTGGCAATATG
ATGCTAGTATCTCTAGCTCTTGCCTATCCGTTGCTTGTGATCTCAGTGGCTGCCTTTATGGTTAATGCCA
CCGTTATGTGCATGGTATCTATAGTAATACTTGGTATTTTAGCCCCTCTTTTCGTGCCAATGTTTTTATT
TGACTATACACGAGGCTATTTTGATAGCTGGGTTAAGCTAATGATTTCGTTTTTACTTCAGCCTATGGTA
GTAGTTACTTTTATGATTACTATGTTTTCGGTTTATGATTTTGGTTTTTACGGAAAATGCCAATATCAAA
GTAAATTGATTCATAATAGTATAGAGGGTGCCTTACAGGGACAAACTTTTAAAAGGGATGTTTTAGTATT
TTTTGTTGATAATGATTGGACAAAATATAGTAAAGAAGATGCAGAAAGTTGTCAAAATAGCTTAGGCTAT
ATGTTAAATAATCCGATTTCAACAGCTTTTAACTTTGCCAAAGACAGTGTAGAACAAATAGTTGGCAGTA
AGCCAAACCAGACTTGCGATCCAAAGGCAGCCGATGCAGATACTAAATGTAATCCAAAACCTGGAGATAG
TAGTACAAGTAGTTTCCTCTCTAAATTCCAGTTTTTATCAGGAGTAATTTTAGGTCCGGGAATGTTCTTT
GTTTCTCCTAAATTACTTTTTGAGAAGATTAAAGATATTTTACTTGCTCTAGTTACAGCCTGTTTTACCT
TATATTTAATGTATAATTTTAGCAGCCAGCTAGCTAATTTTGCAGCAGATATGACGGAAGGGGTAGCTCT
TAGCAGCGTTGCCATAAAACCGCAAGCGGTATTTAAAGCCGCAATGGCTGCACTTGCCGCTGCAGGTAAT
GCAACCAAAGGTCTTGACCAATTCGCTACCAAAGGTGGAGGTGGTGGTGATTTACTCAGCACTAAAGGTG
GAAGAGCCGGTGATTTAGTAAAAGGTAGCGGCGGTGGCGGTGGTAGTGAAGGAGGTGATTCTTTCACATC
AGGTGGTCTTAGAGAAACGTCTAGTACGGCTGCAACTCCATCTTCTGCACTAAGTTCTGTTGGTAAAAGT
GTAGGCGGCACAGCAACACCAAGTAGTGCTTCTGAAGAAATGCTTGATACTAGCTTTAGTAATAGAAAAC
CTATAGAAGCACCTGTGTCTCAACCAACGACAGTTTCAACGCAAATTGATACTGCTATTAAAACTGAGCC
ACCGAAAGTAAGTGCAGCAGAAGTTGTAAGAAATACTGCAGAAGATAAGCTTGAAGATTTATCAAGTAAG
CTTAATGTTACAAAAGAAATTAAAGAAGCTGTACCTGAATCTCAGAAAGAAGAACCAAAAGAGCCAAGAG
TAAAACATACTACTGAGGTGGAACCGGAACTTAATTTAGACGAAAACCTTGGAGTTACACGTACTATCAG
AGGGCTTGATAAGGACAGAAAATTTACCGAACAAGAAAGTCACGAATTAAAGATAGGTGAGGCAGGATAC
GTAAAGCAAGAGATGAGAAATGCTCAAATTCGTGATAGAAGAGCAGCATTTGAAAAAGAAACGGAGGAAT
TATATCGTAGTGTGGGTGGTAGAGCAAAAGATAAAGCGACCGAGCGAAATGATGGAACGATTGAAAATAG
AAGCAAGAAAATAGATAGTGGTTCCGATGAAAATCCATAA
 Primer design