SecReT4
Protein ID: 91206081
T4SS name [ID]VirB [492]
Gene symbolvirB4-1
Locus tagRBE_1266
StrainRickettsia bellii RML369-C
Repliconchromosome [GenBank: NC_007940] [Browse all T4SS(s) in this replicon]
Location [Strand]1366228..1368645 [-]
Producttype IV secretion system ATPase VirB4
Component typeVirB4
UniProt IDQ1RH17
KEGG IDrbe:RBE_1266
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 3.2e-67, Aligned region: 194..399
AAA_10 [PF12846], Evalue: 7.1e-37, Aligned region: 452..727
AAA_23 [PF13476], Evalue: 1.5e-05, Aligned region: 444..553
Protein Sequence: 805 a.a.     [Download]
>gi|91206081|ref|YP_538436.1| type IV secretion system ATPase VirB4 [Rickettsia bellii RML369-C]
MKLFRTRAANELRAKQDRPTSHFIPYKCHWDSNTILTKDNSLLQVIKINGFSFETADDEDLDIKKNIRNA
LLKNMASGNIVVYFHTIRRRKAVIFDDTEFTYDPTVKVPNDFITYLGAEWRKKHAGARSFFNELYVSILY
KPDTGGAAIVEYFLKKLRQKSNKNVWENDMKEMKENLQEMSNRIVNTFRSYGARILGVRKTPTGNYCEML
EFLSSLVNCGDSPGPVALPRSTIDEYLPTHRLFFDSRTIEARSSIGTKYAGIISILEYGPTTSAGIFDGF
LQMPFEFVMTQSFIFANRTVAIGKMQLQQNRMIQAGDKATSQIAEISTALDMATSGDIGFGEHHLSLLCS
ANSIKALEDILSMASVELSNSGIQPVREKINMEPSYWGQLPGNMEYIVRTSTINTLNMASFASQHNYPIG
KVRNNHWGEYVTVLDTTSGTPFYFNFHVRDVGHTLIIGPTGAGKTVLMNFLCAEAQKFKPRMFFFDKDRG
AEIFIRALNGVYTVIDPGLKCNFNPLQLEDTSENRTFILEWLRVLVTSNGESITAQDNKILSQAVSGNFR
LEKKDRRLSNVVAFLGIDTPDSLASRIAMWVGNGSHAKVFDNEVDDIDLQKARVFGFDMTELLKDPISLA
PVLLYIFHRINISLDGQKTMIVLDEAWALIDNPVFAPKIKDWLKVLRKLNTFVIFATQSVEDAAKSRISD
TLIQQTATQIFLPNLKATDIYRSAFMLSQREYILIKTTDPTTRYFLVKQGVDAVVAKVNLDGMNNIISVL
SGRVETVILLDQIREKYGNDPEKWLPIFYEAVKTL
 
Nucleotide Sequence: 2418 bp     [Download]
>gi|91204815|ref|NC_007940.1|:c1368645-1366228 Rickettsia bellii RML369-C chromosome, complete genome
ATGAAGTTATTTAGAACTAGAGCAGCTAATGAATTAAGAGCTAAACAAGATAGACCTACTTCGCATTTTA
TCCCTTATAAATGCCATTGGGATAGTAATACCATTTTAACTAAAGATAATTCGCTTTTACAAGTTATTAA
AATAAATGGTTTTTCTTTTGAAACAGCCGATGATGAAGATTTAGATATTAAAAAGAATATAAGGAATGCC
TTACTTAAAAACATGGCTTCAGGAAATATTGTTGTATATTTTCATACTATCAGAAGACGTAAAGCAGTAA
TATTTGACGATACTGAATTTACTTATGATCCTACTGTAAAAGTACCAAACGATTTTATTACGTATCTTGG
AGCAGAATGGCGTAAAAAACACGCAGGTGCTAGATCGTTTTTTAATGAATTATATGTCAGTATTTTATAC
AAACCTGATACTGGTGGTGCAGCTATAGTTGAGTATTTTTTAAAAAAGCTTAGACAAAAATCTAATAAAA
ATGTTTGGGAAAATGACATGAAAGAGATGAAAGAAAATCTCCAAGAAATGTCAAACAGAATAGTTAATAC
ATTTAGAAGTTATGGAGCTAGGATTCTTGGAGTTCGTAAAACTCCTACAGGTAATTATTGTGAAATGCTA
GAATTCCTTTCATCTTTAGTTAATTGTGGCGACTCGCCAGGTCCAGTAGCATTGCCACGTAGTACTATAG
ATGAATATTTACCAACACATCGTTTGTTTTTTGATTCACGTACTATTGAGGCAAGAAGTTCGATTGGAAC
TAAATATGCTGGAATAATAAGTATTCTTGAATATGGACCTACTACTTCTGCAGGGATTTTTGATGGATTT
TTGCAAATGCCTTTTGAGTTTGTAATGACTCAGAGTTTTATATTTGCTAACAGAACTGTAGCAATTGGTA
AAATGCAATTACAGCAAAATAGAATGATACAAGCAGGTGATAAAGCTACTTCACAAATTGCTGAAATATC
AACAGCACTTGATATGGCAACTAGTGGTGATATTGGCTTTGGAGAACATCATCTATCACTTTTATGTTCT
GCAAATAGTATTAAAGCTTTAGAAGATATATTATCAATGGCATCTGTTGAGCTTTCTAACTCAGGAATTC
AGCCTGTTAGAGAAAAAATTAACATGGAGCCTAGCTATTGGGGACAGTTGCCGGGAAATATGGAGTATAT
AGTTCGTACATCCACCATAAATACCCTTAATATGGCTAGTTTTGCCTCTCAACATAACTACCCTATTGGA
AAGGTGAGAAATAACCATTGGGGCGAATATGTCACAGTGCTAGATACAACTTCAGGTACTCCGTTCTATT
TTAATTTCCATGTAAGAGATGTTGGGCATACTTTAATCATAGGTCCGACTGGTGCCGGTAAAACTGTTCT
TATGAATTTCTTATGTGCTGAAGCACAAAAATTCAAACCACGTATGTTCTTTTTTGATAAAGATCGTGGT
GCTGAAATATTTATCAGAGCTTTAAACGGTGTTTATACAGTTATAGATCCAGGTTTAAAATGTAACTTTA
ACCCATTGCAGCTTGAAGATACTAGTGAAAATAGAACGTTTATTTTAGAGTGGTTAAGGGTGCTTGTAAC
TTCTAATGGTGAGAGTATAACAGCACAAGATAATAAAATATTATCGCAAGCAGTGAGTGGTAATTTTAGA
CTAGAAAAAAAAGATAGACGGCTTAGTAATGTAGTAGCGTTTCTTGGAATCGATACACCAGATAGTCTAG
CAAGTAGAATTGCGATGTGGGTTGGAAATGGTTCTCACGCTAAAGTATTTGATAATGAAGTAGATGATAT
TGATTTGCAAAAAGCTAGAGTGTTTGGCTTTGATATGACTGAATTACTTAAAGACCCAATAAGCCTTGCT
CCGGTATTGTTGTATATTTTCCATCGCATAAATATTTCTTTGGATGGGCAAAAAACTATGATAGTACTTG
ATGAGGCTTGGGCTTTAATCGATAATCCAGTATTTGCTCCTAAAATCAAAGATTGGTTAAAAGTGTTGAG
AAAACTAAATACTTTTGTTATATTTGCTACTCAAAGCGTAGAAGATGCAGCAAAAAGTAGAATTAGTGAT
ACGTTAATTCAGCAGACGGCTACACAAATTTTCCTACCTAACCTTAAAGCTACCGATATTTATCGTAGTG
CTTTTATGTTAAGTCAGAGAGAATATATTTTGATTAAAACTACCGACCCTACGACACGTTACTTTTTGGT
AAAACAAGGAGTAGACGCAGTAGTTGCTAAAGTGAATTTAGACGGTATGAATAATATAATTAGTGTTTTA
TCGGGTAGAGTGGAAACTGTTATACTACTCGATCAAATTAGGGAAAAATACGGGAATGATCCGGAAAAAT
GGTTGCCTATATTCTATGAAGCAGTTAAGACATTGTAG
 Primer design