SecReT4
Protein ID: 91206090
T4SS name [ID]VirB [492]
Gene symbolvirB3
Locus tagRBE_1275
StrainRickettsia bellii RML369-C
Repliconchromosome [GenBank: NC_007940] [Browse all T4SS(s) in this replicon]
Location [Strand]1376912..1377199 [-]
Producttype IV secretion system protein VirB3
Component typeVirB3
UniProt IDQ1RH08
KEGG IDrbe:RBE_1275
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 5.8e-17, Aligned region: 8..90
Protein Sequence: 95 a.a.     [Download]
>gi|91206090|ref|YP_538445.1| type IV secretion system protein VirB3 [Rickettsia bellii RML369-C]
MAGTLATDLLFVGLTRPPMIFGVSIKFAALNMIMTMIVFIWNNGIMILFIAAGLHLIAYIICFKEPRFIE
LYMNKMSRTSQCPNKFYYGANSYGI
 
Nucleotide Sequence: 288 bp     [Download]
>gi|91204815|ref|NC_007940.1|:c1377199-1376912 Rickettsia bellii RML369-C chromosome, complete genome
ATGGCAGGAACATTAGCAACCGATCTTTTATTCGTAGGGCTAACTAGACCACCCATGATATTTGGTGTGA
GTATTAAATTTGCAGCATTAAATATGATCATGACTATGATAGTATTTATTTGGAATAACGGCATTATGAT
TTTATTCATCGCAGCAGGTCTACATTTAATAGCCTATATTATATGCTTTAAAGAGCCACGATTTATAGAG
TTGTATATGAATAAAATGTCAAGGACTAGCCAATGTCCTAATAAATTTTATTATGGGGCAAATTCATACG
GAATTTGA
 Primer design