SecReT4
Protein ID: 91206352
T4SS name [ID]Tra_F [101]
Gene symboltraL
Locus tagUTI89_P107
StrainEscherichia coli UTI89
Repliconplasmid pUTI89 [GenBank: NC_007941] [Browse all T4SS(s) in this replicon]
Location [Strand]79808..80119 [+]
Productconjugal transfer pilus assembly protein TraL
Component typeTraL_F
UniProt IDQ1R1T1
KEGG IDeci:UTI89_P107
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 3.2e-37, Aligned region: 9..103
Protein Sequence: 103 a.a.     [Download]
>gi|91206352|ref|YP_538706.1| F fimbriae outer membrane protein [Escherichia coli UTI89]
MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICIGWGIITSKYLFGIGAAVLVYFGIKKLKKGRGS
SWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|91206245|ref|NC_007941.1|:79808-80119 Escherichia coli UTI89 plasmid pUTI89, complete sequence
ATGTCGGGAGACGAGAATAAACTTAAGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCTGGT
TTGGCCTGCCACTGGATGAACTGATCCCCGCAGCAATCTGTATTGGCTGGGGTATCATAACATCGAAATA
TCTGTTCGGTATTGGTGCAGCGGTTCTGGTTTATTTCGGGATTAAAAAACTGAAAAAAGGGCGGGGCAGT
TCCTGGTTACGTGACCTGATTTACTGGTATATGCCAACAGCCCTGCTGCGCGGTATTTTTCATAATGTTC
CCGATTCGTGTTTCCGGCAGTGGATTAAATAG
 Primer design