SecReT4
Protein ID: 91206370
T4SS name [ID]Tra_F [101]
Gene symboltraF
Locus tagUTI89_P125
StrainEscherichia coli UTI89
Repliconplasmid pUTI89 [GenBank: NC_007941] [Browse all T4SS(s) in this replicon]
Location [Strand]93687..94460 [+]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDQ1R1R3
KEGG IDeci:UTI89_P125
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.2e-78, Aligned region: 33..247
Protein Sequence: 257 a.a.     [Download]
>gi|91206370|ref|YP_538724.1| F pilus assembly periplasmic protein TraF [Escherichia coli UTI89]
MKEKVMKGMKMNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAAPRQEPDIMQKLTALQT
ATKRALYEAILYPGVDNFVKYFRLQNYWTQQAGLFTMSAKKAMLAHPELDYNLQYSHYNGTVRNQLAADQ
AQQRQAIAKLAEHYGIMFFYRGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQR
LGVKYFPAMMLVDPKQGSVRPLSYGFISQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 774 bp     [Download]
>gi|91206245|ref|NC_007941.1|:93687-94460 Escherichia coli UTI89 plasmid pUTI89, complete sequence
ATGAAAGAAAAAGTGATGAAAGGAATGAAGATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCTTTA
TTTTTCCGGCGTCAGGAAAAGATGCAGGCTGGCAGTGGTATAACGAGAAAATAAATCCGAAGGAAAAAGA
AAATAAACCAGTACCTGCAGCCCCCCGTCAGGAGCCGGACATTATGCAGAAACTGACCGCGCTGCAGACG
GCAACAAAGCGGGCGCTGTACGAAGCTATTCTGTATCCCGGCGTGGATAATTTTGTGAAATATTTCCGGC
TGCAGAATTACTGGACTCAGCAGGCCGGGCTTTTCACCATGAGCGCCAAAAAAGCCATGCTGGCGCATCC
CGAACTGGACTATAACCTGCAGTACAGCCATTACAACGGCACGGTCCGGAACCAGCTGGCGGCAGACCAG
GCGCAGCAGCGACAGGCCATTGCGAAACTGGCTGAACACTACGGCATCATGTTCTTTTACCGGGGGCAGG
ACCCCATCGACGGGCAGCTGGCGCAGGTCATTAATGGCTTCAGGGATACCTATGGTCTGAGTGTTATTCC
CGTTTCCGTGGATGGCGTGATTAATCCGCTGTTGCCGGATTCCCGGACTGACCAGGGGCAGGCGCAGCGC
CTCGGTGTGAAATATTTCCCGGCCATGATGCTGGTTGACCCGAAACAGGGCAGTGTTCGCCCGTTATCAT
ACGGCTTTATTTCACAGGACGACCTGGCAAAACAGTTCCTGAACGTTTCTGAAGATTTTAAACCGAATTT
TTAA
 Primer design