SecReT4
Protein ID: 91206373
T4SS name [ID]Tra_F [101]
Gene symboltraQ
Locus tagUTI89_P128
StrainEscherichia coli UTI89
Repliconplasmid pUTI89 [GenBank: NC_007941] [Browse all T4SS(s) in this replicon]
Location [Strand]95212..95496 [+]
Productconjugal transfer pilin chaperone TraQ
Component typeTraQ_F
UniProt IDQ1R1R0
KEGG IDeci:UTI89_P128
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 1.4e-49, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|91206373|ref|YP_538727.1| F pilin synthesis protein [Escherichia coli UTI89]
MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSLE
EREALEARQQAMMEGQQEGGHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>gi|91206245|ref|NC_007941.1|:95212-95496 Escherichia coli UTI89 plasmid pUTI89, complete sequence
ATGATAAGTAAACGCAGATTCTCTTTACCACGGCTTGATATTACGGGAATGTGGGTATTTTCCCTGGGTG
TCTGGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGTTGAT
TGCGGCCATCCTTGTGCTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCACGTGTCAGCCTGGAA
GAGCGTGAGGCACTGGAAGCCAGGCAACAGGCCATGATGGAAGGGCAGCAGGAGGGCGGACATGTCTCTC
ACTAA
 Primer design