SecReT4
Protein ID: 91206385
T4SS name [ID]Tra_F [101]
Gene symboltraX
Locus tagUTI89_P140
StrainEscherichia coli UTI89
Repliconplasmid pUTI89 [GenBank: NC_007941] [Browse all T4SS(s) in this replicon]
Location [Strand]110506..111309 [+]
Productconjugal transfer pilus acetylation protein TraX
Component typeTraX_F
UniProt IDQ1R1P8
KEGG IDeci:UTI89_P140
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 8.2e-53, Aligned region: 51..266
Protein Sequence: 267 a.a.     [Download]
>gi|91206385|ref|YP_538739.1| F pilin acetylation protein [Escherichia coli UTI89]
MTCRKRKPWAETDTGRQTLMTTDNTNTTRNDSLAARTDTWLQSFLVWSPGQRDIIKTVALVLMVLDHINL
IFQLKQEWMFLAGRGAFPLFALVWGLNLSRHAHIRQPAINRLWGWGIIAQFAYYLAGFPWYEGNILFAFA
VAAQVLTWCETRSGWRTAAAILLMALWGPLSGTSYGIAGLLMLAVSYRLYRAEDRAERLALLACLLAVIP
ALNLASSDAAAVAGLVMTVLTVGLVSCAGKSLPRFWPGDFFPVFYACHLAVLGVLAL
 
Nucleotide Sequence: 804 bp     [Download]
>gi|91206245|ref|NC_007941.1|:110506-111309 Escherichia coli UTI89 plasmid pUTI89, complete sequence
GTGACCTGCAGAAAGAGAAAACCCTGGGCGGAGACTGATACAGGAAGACAAACACTGATGACAACGGATA
ACACGAACACGACACGTAACGATTCACTGGCTGCACGGACCGATACCTGGTTGCAGTCGTTTCTGGTCTG
GTCACCCGGACAGCGGGATATCATCAAAACGGTGGCGCTGGTGCTGATGGTACTGGACCACATCAATCTG
ATATTCCAGCTGAAGCAGGAATGGATGTTTCTGGCCGGGCGAGGAGCCTTTCCGCTGTTTGCCCTGGTGT
GGGGGCTGAATCTGTCCCGTCATGCGCATATCCGGCAACCGGCCATTAACCGGCTGTGGGGATGGGGAAT
TATTGCCCAGTTCGCATATTATCTGGCCGGCTTTCCCTGGTATGAGGGGAATATCCTGTTTGCCTTTGCA
GTGGCGGCACAGGTGCTGACGTGGTGTGAAACGCGCAGTGGGTGGCGTACAGCAGCGGCCATTCTTCTGA
TGGCCCTGTGGGGGCCTTTGTCCGGCACCAGTTACGGCATTGCCGGGCTGCTGATGCTGGCGGTCAGTTA
CCGACTGTACCGGGCGGAAGACAGAGCGGAACGTCTGGCGCTGCTTGCATGCCTGCTGGCCGTTATTCCG
GCACTTAACCTTGCCTCCAGTGATGCAGCGGCGGTGGCCGGTCTTGTAATGACGGTGCTGACCGTTGGTC
TGGTGTCGTGTGCAGGAAAATCATTACCCCGTTTCTGGCCCGGGGATTTTTTCCCGGTATTCTACGCCTG
TCATCTGGCTGTGCTGGGCGTTCTGGCGTTGTGA
 Primer design