SecReT4
Protein ID: 91780500
T4SS name [ID]VirB [362]
Gene symbol-
Locus tagBxe_C0453
StrainBurkholderia xenovorans LB400
Repliconchromosome 3 [GenBank: NC_007953] [Browse all T4SS(s) in this replicon]
Location [Strand]473442..474188 [+]
Productputative type IV secretion system protein VirB8/TraJ
Component typeVirB8
UniProt IDQ13HT2
KEGG IDbxe:Bxe_C0453
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.9e-52, Aligned region: 16..226
Protein Sequence: 248 a.a.     [Download]
>gi|91780500|ref|YP_555707.1| putative type IV secretion system protein VirB8/TraJ [Burkholderia xenovorans LB400]
MSSERDARESRDYRRALDFEVSVAHLQERSERRAWHVAMGSVVVAILCAVALAVMVPFYRVVPLPIEVDR
LTGEAQVIDVLDAKQTHMRDIEDKHWVEAYVRSRERYDWGLLQMDYDRVLDMSDDRVARDYRSIYSGPDA
LDRQLGANTQRRIRILSTTLVPDEPGRAVVHIERTTRKNGIDNAEPPQRFVVTLAFTYRPSVFTRERTAI
ENPFGFRVTAYSRDPEYTPTAVSPASSPTLSPAPGGAP
 
Nucleotide Sequence: 747 bp     [Download]
>gi|91780071|ref|NC_007953.1|:473442-474188 Burkholderia xenovorans LB400 chromosome 3, complete genome
ATGAGTAGTGAGCGTGACGCCCGCGAATCACGTGATTATCGCCGGGCACTCGATTTCGAGGTGTCGGTCG
CGCACCTGCAGGAGCGCTCGGAGCGTCGGGCATGGCACGTGGCTATGGGCTCCGTGGTGGTCGCGATCCT
GTGTGCTGTCGCACTGGCCGTGATGGTCCCGTTCTATCGGGTGGTGCCGCTGCCGATCGAGGTCGACCGT
CTGACCGGTGAAGCACAGGTGATCGACGTGCTCGACGCGAAGCAGACGCACATGCGGGATATCGAGGACA
AGCACTGGGTGGAAGCGTACGTGCGCTCGCGTGAGCGCTACGACTGGGGCCTGCTGCAGATGGACTACGA
CCGCGTGCTCGACATGAGCGACGACCGTGTCGCGCGGGACTACCGGTCGATCTACAGCGGCCCGGATGCA
CTGGACCGGCAGCTCGGGGCGAACACACAGCGGCGTATCCGCATCCTCTCGACGACGCTCGTGCCCGACG
AACCCGGCCGTGCTGTCGTGCATATCGAACGCACGACGCGGAAGAACGGCATCGATAACGCGGAGCCCCC
GCAGCGCTTCGTCGTCACGCTCGCCTTCACATACCGGCCGTCCGTCTTCACGCGTGAGCGCACGGCCATC
GAGAATCCCTTCGGCTTCAGGGTGACGGCGTATAGCCGCGATCCCGAATACACCCCCACGGCGGTGTCGC
CCGCGTCGTCGCCGACATTGTCACCTGCTCCGGGAGGTGCGCCATGA
 Primer design