SecReT4
Protein ID: 91780503
T4SS name [ID]VirB [362]
Gene symbol-
Locus tagBxe_C0456
StrainBurkholderia xenovorans LB400
Repliconchromosome 3 [GenBank: NC_007953] [Browse all T4SS(s) in this replicon]
Location [Strand]476219..477358 [+]
Productputative type IV secretion system protein VirB11
Component typeVirB11
UniProt IDQ13HS9
KEGG IDbxe:Bxe_C0456
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.9e-62, Aligned region: 34..341
Protein Sequence: 379 a.a.     [Download]
>gi|91780503|ref|YP_555710.1| putative type IV secretion system protein VirB11 [Burkholderia xenovorans LB400]
MKASAHILSEAPVPADGLLPRLAEDASVRELMRPLAGLLADPALTELVINRPQRVLTETHLGWQAHDCAD
LDFERLMSFAVAIATLTNQEVSALHPVLSALLPGDARVQVVIPPVVPPRTVSVTIRRPSSREKTLDAYGN
EGLFSQTRWHRPAGLDEAMPALRPLDRDLARCLEAREFPAFFERAVRGRLNLVIVGSTGSGKTSFMKTLC
RSIPATERIVTIEDVRELFIHHIENCVHLIYSKGGHGQARVTPADLIASSMRMRPDRVLLAELRGSEAYD
FLKLLTTGHSGSITSYHASSAAVAIERFALMAKEHPEAATWDDVALRRLLFMTIDVVAHMESTALFDETG
VQTGRRWSMTEVWFDPLRRHQTDYHADFR
 
Nucleotide Sequence: 1140 bp     [Download]
>gi|91780071|ref|NC_007953.1|:476219-477358 Burkholderia xenovorans LB400 chromosome 3, complete genome
ATGAAAGCATCGGCCCATATCCTGAGTGAAGCGCCGGTACCGGCTGACGGCCTGCTGCCCAGGCTGGCAG
AGGATGCTTCGGTGCGCGAGCTGATGCGCCCACTCGCGGGGCTGCTCGCAGACCCGGCGCTCACGGAGCT
GGTGATCAACCGGCCGCAGCGCGTGCTGACCGAAACCCATCTCGGATGGCAGGCACACGACTGTGCGGAC
CTTGACTTCGAGCGCCTGATGTCATTCGCGGTGGCGATCGCCACGCTCACAAACCAGGAGGTCTCGGCGC
TGCATCCGGTGCTCTCCGCGCTGCTGCCCGGTGATGCGCGCGTCCAGGTCGTGATCCCGCCGGTGGTGCC
CCCGCGTACCGTGTCGGTGACGATCCGCCGTCCGTCGTCGCGCGAGAAGACACTCGACGCCTACGGAAAC
GAGGGCCTGTTCTCGCAGACTAGATGGCACCGCCCGGCTGGACTTGATGAGGCGATGCCGGCACTGCGCC
CCCTGGATCGGGATCTCGCCAGATGCCTTGAAGCGCGCGAGTTCCCGGCTTTCTTCGAGCGGGCGGTGCG
CGGCCGGCTGAACCTCGTGATCGTGGGCAGCACAGGCTCGGGCAAGACGAGCTTCATGAAGACGCTGTGC
CGGTCCATCCCGGCTACCGAACGCATCGTGACGATTGAGGATGTGCGCGAGCTCTTCATCCATCACATCG
AGAATTGCGTCCACCTGATTTACAGCAAGGGTGGCCACGGCCAGGCGCGGGTGACGCCTGCCGATCTGAT
CGCAAGCTCGATGCGCATGCGCCCTGATCGAGTGCTGCTCGCCGAACTGCGGGGCAGCGAAGCGTACGAC
TTCCTGAAGCTGCTGACGACCGGGCACTCCGGTTCGATCACGAGCTATCACGCGTCGAGTGCCGCCGTTG
CGATTGAACGCTTTGCGTTGATGGCGAAGGAACATCCCGAAGCCGCCACATGGGACGACGTCGCACTGCG
CCGGCTGCTCTTCATGACGATCGACGTTGTGGCGCACATGGAGTCCACCGCGCTCTTCGATGAGACAGGC
GTGCAGACCGGCCGGCGCTGGTCGATGACGGAGGTCTGGTTCGATCCGCTGCGCCGCCATCAGACGGACT
ATCACGCGGATTTCCGGTGA
 Primer design