SecReT4
Protein ID: 91780505
T4SS name [ID]VirB [362]
Gene symbol-
Locus tagBxe_C0458
StrainBurkholderia xenovorans LB400
Repliconchromosome 3 [GenBank: NC_007953] [Browse all T4SS(s) in this replicon]
Location [Strand]477771..479552 [+]
Productputative type IV secretory pathway protein VirD4
Component typeVirD4
UniProt IDQ13HS7
KEGG IDbxe:Bxe_C0458
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.5e-109, Aligned region: 18..450
TraG-D_C [PF12696], Evalue: 1.9e-28, Aligned region: 297..418
TrwB_AAD_bind [PF10412], Evalue: 9.3e-22, Aligned region: 207..432
Protein Sequence: 593 a.a.     [Download]
>gi|91780505|ref|YP_555712.1| putative type IV secretory pathway protein VirD4 [Burkholderia xenovorans LB400]
MSAATHSGGYGGPPLVVGVWRGRYLRFTGQQFVLLAAPARSGKGVGIVVPNLLSYPDSVVVLDIKQENFN
LTAGFRRAHGHDVYLFNPFAEDGRTHRYNPLSAISDGVFRVGDILAIGYALYPVGGHDDFWKDQARNLFL
GIVLLLCEWRDACRTGNTDVPDYPVTMGEVLRQSSGNGMPVKAYLQQALLQNRRLLSGACVDALNRFLAN
DDKVLASILATFNAPLTIWANPIVDAATSANDFDLRDVRKRRMSVYVGITPDHLSEAALLVNLVFSQLVN
LNTRQLPQDSPELKVQCLLLMDEFTSVGKIHIIARAVAYMAGYNLRLLSIVQSVSQLESVYGRADARTFV
TNHAMQIIYAPREQKDANEYSEMLGTFTDRSRSVSRSNAVFGGRGGSSESFSEQRRPLLLPQELKELGRE
KEIILLENTKPILAERICYWRDPVFTSRLVAAPAIPAMDLVRFIAQVERRVRDVQPDDVDEAGVMHIPPE
YLEVLQAWDPRDLPRHLNDVTDEEAAAYVERHFMLLGVPAARVAVAARRLSPSDLDVAELRPADRAPKRK
SARSTGASRKQHGPATSRPTDGSNVVPLHGERR
 
Nucleotide Sequence: 1782 bp     [Download]
>gi|91780071|ref|NC_007953.1|:477771-479552 Burkholderia xenovorans LB400 chromosome 3, complete genome
ATGAGCGCGGCGACGCATTCAGGCGGATACGGTGGACCTCCTCTGGTCGTGGGCGTCTGGCGTGGCCGCT
ATCTGCGGTTCACCGGCCAGCAGTTCGTGCTGCTCGCGGCACCGGCGCGCTCGGGCAAGGGCGTGGGCAT
CGTGGTGCCCAATCTGCTCAGCTACCCGGATTCGGTGGTTGTGCTCGACATCAAGCAGGAGAACTTCAAC
CTGACCGCAGGATTCCGTCGTGCGCACGGGCATGACGTGTACCTGTTCAACCCGTTTGCCGAGGACGGCC
GTACGCACCGGTATAACCCGCTGTCGGCGATTTCGGATGGCGTATTCCGCGTTGGCGACATCCTGGCGAT
CGGCTACGCGCTGTATCCGGTTGGCGGTCACGACGACTTCTGGAAGGACCAGGCACGCAATCTCTTTCTC
GGGATCGTGCTGCTGCTGTGCGAGTGGCGCGATGCGTGCCGCACCGGCAACACCGATGTGCCCGACTACC
CGGTGACGATGGGCGAGGTACTGCGGCAGTCATCGGGCAACGGCATGCCCGTCAAGGCATACCTGCAGCA
GGCGCTGCTGCAGAACCGGCGACTGCTCAGTGGCGCGTGCGTCGATGCGCTCAACCGCTTTCTCGCGAAC
GACGACAAGGTGCTCGCGAGCATTCTCGCAACCTTCAATGCGCCGCTCACGATCTGGGCCAATCCGATTG
TCGACGCCGCGACGAGTGCCAATGACTTCGACCTGCGCGATGTGCGCAAACGGCGCATGTCGGTCTATGT
CGGGATCACGCCGGACCACCTGAGCGAGGCAGCGCTGCTCGTCAACCTTGTGTTCTCACAACTCGTCAAC
CTTAATACGCGACAACTGCCCCAGGACAGTCCGGAGCTGAAGGTCCAGTGTCTGCTGCTGATGGACGAAT
TCACGTCGGTTGGCAAGATTCACATCATTGCCCGCGCAGTCGCCTATATGGCGGGATACAACCTGCGGCT
GCTCTCGATCGTGCAGTCGGTGTCGCAGCTCGAGTCGGTCTATGGCCGGGCGGACGCCAGGACGTTCGTC
ACCAATCACGCGATGCAGATCATCTATGCGCCGCGTGAGCAGAAGGACGCGAACGAATACTCGGAGATGC
TCGGTACCTTCACGGACCGCTCGCGCAGCGTGAGCCGGTCGAACGCGGTATTTGGCGGGCGCGGCGGGTC
GAGCGAGAGTTTCTCTGAGCAGCGCCGTCCGCTGCTGCTGCCGCAGGAGCTGAAGGAACTCGGACGTGAG
AAGGAAATTATCCTGCTCGAAAATACGAAGCCGATCCTGGCGGAGCGGATCTGCTACTGGCGCGACCCTG
TTTTCACGTCACGTCTGGTGGCTGCGCCAGCGATTCCAGCGATGGATCTCGTGCGCTTCATCGCCCAGGT
TGAGCGGCGGGTGAGGGATGTGCAACCGGACGACGTGGACGAAGCCGGCGTGATGCACATTCCCCCGGAG
TATCTGGAAGTGCTGCAGGCCTGGGATCCACGCGACCTGCCACGGCATCTCAACGACGTGACCGACGAAG
AGGCGGCCGCCTACGTCGAGCGACATTTCATGCTGCTGGGCGTGCCCGCTGCGCGCGTGGCCGTGGCAGC
GCGCCGCCTGTCGCCGTCCGATCTTGATGTGGCGGAACTGCGCCCCGCGGATCGAGCGCCGAAACGCAAG
TCCGCGCGCAGCACAGGTGCCTCGCGGAAACAACACGGGCCCGCGACATCGCGCCCAACTGACGGCTCGA
ACGTGGTGCCGCTTCACGGAGAACGCCGATGA
 Primer design