SecReT4
Protein ID: 91783153
T4SS name [ID]VirB [364]
Gene symbol-
Locus tagBxe_A2652
StrainBurkholderia xenovorans LB400
Repliconchromosome 1 [GenBank: NC_007951] [Browse all T4SS(s) in this replicon]
Location [Strand]1999582..2000286 [+]
Producttype IV secretion system protein VirB8/TraJ
Component typeVirB8
UniProt IDQ140D2
KEGG IDbxe:Bxe_A2652
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.1e-52, Aligned region: 13..220
Protein Sequence: 234 a.a.     [Download]
>gi|91783153|ref|YP_558359.1| type IV secretion system protein VirB8/TraJ [Burkholderia xenovorans LB400]
MSAPHDYGRVLDIETSLTHLQERSERRAWHVAYAAVGVAVLSTAALAVMVPFYRVVPLPIEVDRLTGESQ
VIDVLDAHHVHTKEIQDRHWVETYVRARERYDWGLLQMDYDNVLTMSDDVVARDYRGTYSGPDALDRQLG
SGAERRVRILSITLPPDEPGHAVVHIERTSFRNGQADAEPTQRFVITLAYTYQPSVFTRESVAIANPFGF
KVTAYSRDPEYTPQASASNAGVKP
 
Nucleotide Sequence: 705 bp     [Download]
>gi|91781384|ref|NC_007951.1|:1999582-2000286 Burkholderia xenovorans LB400 chromosome 1, complete sequence
ATGAGCGCGCCGCACGACTACGGGCGTGTGCTCGACATCGAGACGTCGCTCACTCACCTGCAGGAACGCT
CCGAGCGGCGGGCCTGGCACGTCGCCTATGCAGCGGTCGGCGTGGCCGTGCTCAGTACCGCAGCACTCGC
GGTGATGGTGCCGTTCTATCGCGTCGTGCCGCTGCCGATCGAGGTCGATCGCCTGACGGGTGAGTCTCAG
GTCATCGATGTGCTCGATGCCCACCATGTGCATACGAAGGAAATCCAGGACAGGCACTGGGTCGAGACCT
ATGTGCGTGCGCGCGAGCGTTACGACTGGGGCCTGCTGCAGATGGACTACGACAACGTGCTCACCATGAG
CGATGACGTGGTCGCGCGCGATTACCGCGGCACCTACAGCGGTCCCGACGCGCTGGACCGGCAACTGGGG
TCCGGCGCCGAGCGGCGTGTTCGCATTCTCTCAATCACGCTGCCGCCAGACGAACCGGGTCACGCGGTCG
TGCATATCGAGCGCACATCGTTCAGGAACGGCCAGGCCGACGCCGAGCCGACGCAGCGTTTCGTGATCAC
GTTGGCCTATACCTATCAGCCATCCGTGTTCACGCGCGAGAGCGTGGCCATTGCCAATCCGTTCGGATTC
AAGGTCACGGCCTACAGCCGCGATCCCGAATACACGCCGCAGGCGTCGGCGTCGAATGCCGGAGTTAAGC
CATGA
 Primer design