SecReT4
Protein ID: 91783156
T4SS name [ID]VirB [364]
Gene symbol-
Locus tagBxe_A2649
StrainBurkholderia xenovorans LB400
Repliconchromosome 1 [GenBank: NC_007951] [Browse all T4SS(s) in this replicon]
Location [Strand]2002341..2003459 [+]
Producttype IV secretion system protein VirB11
Component typeVirB11
UniProt IDQ140C9
KEGG IDbxe:Bxe_A2649
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.5e-58, Aligned region: 31..339
Protein Sequence: 372 a.a.     [Download]
>gi|91783156|ref|YP_558362.1| type IV secretion system protein VirB11 [Burkholderia xenovorans LB400]
MTPRTDMPDSSRDPGLARLPEDASVRELMRPFAPLLEDADVTELVINRPQRVLTEDSRGWHGYDCPDLDF
DRLVSFAVAVATLTNQEVSSQHPILSALLPGDARIQIVVPPVVPPRTVSITIRRPSAREKTLDEYPGEGL
FDDTVWHRPDGLDAVLAVLRPTDRKLIQCLEARNWGAFFELAVIDRLNIAIVGNTGSGKTSFMKTLCRSI
PSNERVITIEDVRELFIRHIENCAHLLYSKGGRGQARVTPADLIASTMRMRPDRVLLAELRGAEAYDFLK
LLTTGHAGSITSYHAPNTAVAIERFALMAKEHPEAAAWDDAALKRLLFLTIDVVAHMESRSFFNAAGEQT
GRRWGMTEVWFDPVRKARTAFV
 
Nucleotide Sequence: 1119 bp     [Download]
>gi|91781384|ref|NC_007951.1|:2002341-2003459 Burkholderia xenovorans LB400 chromosome 1, complete sequence
ATGACACCCCGCACGGACATGCCGGATTCGTCCCGCGACCCGGGTCTCGCCCGGTTGCCCGAAGACGCCT
CCGTGCGCGAGTTGATGCGGCCGTTCGCGCCGCTGCTCGAGGATGCCGACGTGACAGAACTCGTGATCAA
CCGGCCGCAGCGCGTCCTGACCGAAGACTCGCGTGGTTGGCATGGCTACGACTGCCCGGATCTTGATTTC
GACCGGCTGGTGTCTTTCGCCGTGGCAGTCGCTACCCTGACGAATCAGGAGGTCTCGTCCCAGCATCCGA
TCCTGTCAGCGTTGCTGCCAGGGGATGCACGCATTCAGATCGTGGTGCCGCCCGTCGTACCGCCGCGCAC
GGTCTCAATTACGATCCGCCGTCCGTCGGCACGCGAAAAGACCCTCGACGAATATCCTGGTGAAGGGCTG
TTCGACGACACAGTCTGGCATCGTCCGGATGGTCTTGACGCAGTGTTGGCAGTGTTGCGGCCGACAGACC
GGAAGCTCATCCAGTGCCTGGAGGCACGGAACTGGGGTGCGTTTTTTGAGCTGGCTGTCATCGATCGTCT
GAATATCGCGATCGTCGGCAATACGGGTTCCGGCAAGACCAGTTTCATGAAGACCCTCTGTCGTTCGATT
CCATCGAACGAGCGGGTCATCACGATTGAGGATGTCAGGGAACTCTTCATCCGGCATATCGAGAACTGTG
CCCATTTGCTCTATAGCAAAGGGGGGCGTGGTCAGGCGCGTGTAACACCCGCTGACCTGATCGCCAGTAC
GATGCGGATGCGTCCCGATCGCGTGCTGCTGGCCGAGCTGCGCGGCGCCGAAGCCTATGACTTCCTGAAG
CTCCTGACGACGGGCCATGCGGGTTCGATCACGAGCTACCACGCGCCCAATACCGCGGTTGCGATCGAGC
GTTTCGCGCTGATGGCCAAGGAACACCCGGAGGCTGCCGCCTGGGACGATGCCGCGCTCAAGCGCCTGCT
GTTCCTGACCATCGATGTCGTCGCACACATGGAGTCGCGTTCGTTCTTCAATGCAGCGGGCGAGCAGACA
GGCAGGCGCTGGGGCATGACGGAAGTCTGGTTCGACCCGGTGCGCAAGGCACGCACCGCGTTCGTGTAG
 Primer design