SecReT4
Protein ID: 91783158
T4SS name [ID]VirB [364]
Gene symbol-
Locus tagBxe_A2647
StrainBurkholderia xenovorans LB400
Repliconchromosome 1 [GenBank: NC_007951] [Browse all T4SS(s) in this replicon]
Location [Strand]2003837..2005567 [+]
ProductType IV secretory pathway protein VirD4
Component typeVirD4
UniProt IDQ140C7
KEGG IDbxe:Bxe_A2647
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 5e-110, Aligned region: 12..450
TraG-D_C [PF12696], Evalue: 6e-29, Aligned region: 296..417
TrwB_AAD_bind [PF10412], Evalue: 9.6e-23, Aligned region: 202..431
Protein Sequence: 576 a.a.     [Download]
>gi|91783158|ref|YP_558364.1| Type IV secretory pathway protein VirD4 [Burkholderia xenovorans LB400]
MTMRAHVDTTPAIVVGVWRGRYLRFTGQQFVLMAAPARSGKGVGIVIPNLLSFPDSVVVLDIKQENYAVT
AGFRRAHGQDVYLFNPFAEDGRTHRYNPLSAISDGLFRVGDILAIGYALYPSGGHDDFWKDQARNLFLGI
VLLLCEWRDARRAAKGESIPNYPVTMGEVLRQSSGNGMPVKTWLQRALVQHRDLLSGSCVDAMNRFLSND
DKVLASVLATFNAPLTIWANPVVDAATSANDFDLRDVRRRRMSVYIGITPDHLSEAALLVNLVFSQLVNL
NTKQLPEADPALKFQCLVLLDEMTSIGKIQIIARAVAYMAGYNLRLLSIVQSIAQLESVYGRADARTFIT
NHAMQILYAPREQKDANDYSEMLGTLTDQSRSVSRSNAIFGGRSGSSESVSEQRRPLLLPQELKELGREK
EIIVLENTRPILADKICYWRDPEFSSRVMTAPSVPAMNLAHFSAVVERRLRYLRSDEIDPEGAGLIHLPP
EYLEVLQAWDPRDLPPNLADISEDEAVAYVERHFVLLGIPARKVERVGRRLGADDLDVAELDFVEPAQRA
APNGSQAGSQSMGALQ
 
Nucleotide Sequence: 1731 bp     [Download]
>gi|91781384|ref|NC_007951.1|:2003837-2005567 Burkholderia xenovorans LB400 chromosome 1, complete sequence
ATGACGATGCGCGCACACGTTGACACCACACCTGCGATCGTCGTTGGAGTATGGCGCGGGCGTTACCTGC
GCTTTACCGGCCAGCAGTTTGTGCTGATGGCTGCGCCCGCCCGTTCGGGTAAGGGCGTCGGCATTGTGAT
TCCGAATCTGCTCAGCTTTCCCGATTCGGTGGTGGTGCTCGATATCAAGCAGGAAAACTACGCCGTTACG
GCTGGCTTCCGGCGGGCACACGGGCAGGACGTCTATCTCTTCAACCCGTTTGCCGAAGACGGCCGCACGC
ATCGCTATAACCCGCTGTCGGCGATCTCGGATGGCCTGTTTCGGGTCGGCGACATTCTCGCAATCGGCTA
TGCCTTGTATCCGTCGGGCGGCCACGACGATTTCTGGAAAGACCAGGCGAGAAACCTGTTCCTCGGCATC
GTGTTGCTGCTGTGCGAATGGCGTGATGCGCGCCGGGCGGCCAAGGGCGAGTCGATTCCCAACTACCCGG
TCACGATGGGTGAGGTGCTGCGGCAGTCGTCGGGCAATGGCATGCCGGTGAAGACCTGGCTTCAGCGCGC
ACTGGTCCAGCATCGCGACCTGCTGTCGGGATCGTGCGTCGACGCGATGAACCGTTTCCTGTCGAACGAC
GACAAGGTGCTGGCCAGTGTACTGGCGACGTTCAACGCGCCGCTGACGATCTGGGCCAATCCGGTTGTCG
ATGCGGCGACGAGTGCGAACGATTTCGACCTGCGGGATGTGCGCCGCCGCCGCATGTCGGTCTATATCGG
CATCACACCGGACCATCTGTCGGAAGCGGCCCTGCTCGTCAATCTCGTGTTCTCGCAGCTCGTCAACCTG
AACACGAAGCAATTGCCCGAAGCCGATCCGGCGCTGAAATTCCAGTGCCTGGTGTTGCTCGACGAGATGA
CCTCGATCGGCAAGATCCAGATCATCGCGCGCGCCGTCGCCTATATGGCCGGCTACAACCTGCGCCTGCT
GTCGATCGTCCAGTCGATCGCGCAGCTCGAATCGGTGTACGGGCGCGCCGATGCCCGCACCTTCATTACG
AACCACGCGATGCAGATCCTCTATGCGCCGCGCGAGCAGAAGGATGCGAACGATTACTCGGAAATGCTCG
GCACGTTGACCGACCAGTCGCGCAGCGTCAGCCGTTCAAATGCGATTTTCGGTGGCCGGAGTGGATCGAG
TGAGAGTGTGTCCGAGCAGCGCCGCCCGTTGCTATTGCCGCAGGAACTGAAGGAGCTGGGGCGCGAGAAG
GAAATCATCGTGCTCGAGAACACTCGTCCGATTCTGGCCGACAAGATCTGCTACTGGCGCGATCCCGAGT
TTTCCTCTCGCGTGATGACCGCGCCCTCTGTACCGGCCATGAACCTGGCCCATTTCAGCGCCGTGGTCGA
ACGCCGGCTGCGCTATCTGCGTTCCGACGAAATCGATCCGGAAGGTGCCGGGCTGATCCATCTGCCGCCC
GAGTATCTGGAAGTGCTGCAGGCGTGGGATCCCCGTGACCTGCCGCCGAACCTCGCCGATATCAGCGAGG
ACGAGGCTGTCGCCTACGTGGAGCGGCATTTCGTGCTGCTGGGCATTCCGGCCAGGAAGGTCGAGCGCGT
AGGGCGTCGTCTGGGCGCTGACGATCTTGACGTGGCGGAGCTCGATTTCGTTGAACCGGCGCAGCGCGCG
GCCCCGAATGGTTCGCAAGCCGGCTCACAGTCGATGGGAGCCCTGCAATGA
 Primer design