SecReT4
Protein ID: 91784039
T4SS name [ID]VirB [365]
Gene symbol-
Locus tagBxe_A1764
StrainBurkholderia xenovorans LB400
Repliconchromosome 1 [GenBank: NC_007951] [Browse all T4SS(s) in this replicon]
Location [Strand]2962622..2964349 [-]
Producttype IV secretory pathway protein VirD4
Component typeVirD4
UniProt IDQ13XJ6
KEGG IDbxe:Bxe_A1764
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3e-109, Aligned region: 19..452
TraG-D_C [PF12696], Evalue: 2.9e-28, Aligned region: 299..420
TrwB_AAD_bind [PF10412], Evalue: 2.8e-21, Aligned region: 211..434
Protein Sequence: 575 a.a.     [Download]
>gi|91784039|ref|YP_559245.1| type IV secretory pathway protein VirD4 [Burkholderia xenovorans LB400]
MTTHASPAYPGSLPAIVVGVWRGRYLRFAGQQFVLLAAPARSGKGVGVVIPNLLSFPDSVVVLDVKQENY
AVTAGFRKACGQDVYLFNPFAEDGRTHRYNPLSAISDGLFRVGDILAIGYALYPPGGHDDFWKDQARNLF
LAIVLLLCEWRDARRAGKGTSIPNYPVTMGEVLRQSSGNGMPVKTYLQRALVQHRDLLSGQCVDALNRFL
SNDDKVLASVLATFNAPLTIWANPVVDAATSANDFDPRDLRRRRISVYIGVTPDHLAEAALIVNLLFSQV
INLNTKQLPEADPTLRFQCLLLLDEMTAIGKIHILARAVAYMAGYNLRLLSIVQSIAQLESVYGRADART
FVTNHAMQILYAPREQKDANDYSEMLGTLTDQSRSVSRSNAIFGGRGGSSENVSEQRRPLLLPQELKELG
REKEIIVLENTKPILADKLCYWRDPEFAARVMTAPEVPAMNLAHFSAVVERRLRDLHPDEIDPDGAGLIN
LPPEYLEVLQAWDPRDLPPNLADISEDDAVAYVERHFMLLGVPAKKVELARRRLVAGDLDVAELDFVAPA
RRAMSNGSQATGVLQ
 
Nucleotide Sequence: 1728 bp     [Download]
>gi|91781384|ref|NC_007951.1|:c2964349-2962622 Burkholderia xenovorans LB400 chromosome 1, complete sequence
ATGACGACGCACGCATCGCCCGCATACCCCGGTTCCCTGCCTGCGATTGTCGTGGGCGTATGGCGTGGCC
GTTACCTGCGGTTCGCCGGCCAGCAGTTCGTGCTGCTGGCCGCACCCGCGCGCTCGGGCAAGGGCGTTGG
CGTCGTGATCCCGAACCTGCTCAGTTTTCCGGATTCGGTCGTGGTGCTCGACGTGAAGCAGGAGAACTAC
GCCGTGACAGCGGGTTTCAGAAAAGCCTGTGGGCAAGACGTGTACCTTTTCAATCCGTTCGCCGAGGACG
GTCGCACGCATCGCTACAACCCGCTGTCGGCGATCTCGGACGGTCTGTTCCGGGTGGGCGACATTCTCGC
GATCGGCTACGCGCTGTATCCACCCGGCGGCCACGACGATTTCTGGAAAGACCAGGCCCGAAACCTGTTC
CTTGCCATCGTATTGCTGCTGTGCGAGTGGCGCGATGCGCGTCGCGCCGGCAAGGGCACGTCGATCCCGA
ATTATCCGGTCACGATGGGCGAGGTACTGCGGCAGTCCTCGGGCAACGGCATGCCGGTCAAGACGTATCT
GCAGCGCGCGCTGGTTCAGCATCGGGATCTGCTGTCCGGGCAGTGTGTCGACGCGCTGAACCGCTTCCTG
TCGAACGACGACAAGGTGCTGGCGAGTGTGCTGGCGACGTTCAACGCGCCGCTGACAATCTGGGCCAATC
CGGTTGTCGACGCAGCCACCAGCGCGAACGATTTCGATCCGCGCGATCTGCGTCGGCGCCGTATCTCCGT
CTATATCGGCGTGACACCCGATCACCTGGCCGAAGCGGCGCTGATCGTGAACCTGCTGTTTTCGCAGGTG
ATCAACCTGAATACGAAGCAGCTGCCCGAGGCTGATCCCACGCTCCGGTTCCAGTGTCTGCTGCTGCTCG
ACGAGATGACGGCGATCGGCAAGATCCACATTCTTGCCCGCGCGGTGGCCTACATGGCGGGCTACAACCT
GCGCCTGCTGTCGATCGTCCAGTCGATCGCGCAGCTCGAGTCGGTCTATGGACGGGCCGATGCGCGCACC
TTCGTCACGAACCACGCGATGCAGATTCTCTATGCGCCGCGCGAGCAGAAGGACGCCAACGACTACTCAG
AGATGCTGGGCACGCTGACGGATCAGTCGCGCAGCGTCAGTCGCTCGAACGCGATCTTCGGCGGGCGGGG
CGGGTCGAGCGAGAACGTGTCCGAGCAGCGCCGGCCGCTGCTGTTGCCGCAGGAACTGAAGGAGCTGGGG
CGCGAGAAGGAAATCATCGTGCTCGAAAACACCAAGCCGATCCTGGCCGACAAGCTCTGCTACTGGCGCG
ATCCCGAGTTTGCCGCGCGCGTGATGACCGCACCCGAGGTGCCCGCGATGAACCTCGCGCACTTCAGCGC
CGTGGTCGAAAGGCGGTTGCGTGACCTGCATCCGGACGAGATTGATCCGGACGGCGCGGGCCTGATCAAC
CTGCCGCCTGAATACCTCGAAGTGCTGCAGGCATGGGACCCGCGCGACCTGCCGCCGAACCTGGCAGATA
TCAGCGAGGACGACGCGGTGGCTTACGTGGAGCGGCATTTCATGCTGCTCGGCGTGCCCGCGAAGAAAGT
CGAGCTAGCCCGCCGCCGTCTGGTTGCTGGTGATCTCGATGTCGCCGAACTTGATTTCGTTGCGCCGGCA
CGGCGCGCCATGTCGAATGGTTCGCAGGCGACGGGAGTGCTGCAATGA
 Primer design