SecReT4
Protein ID: 91784041
T4SS name [ID]VirB [365]
Gene symbol-
Locus tagBxe_A1762
StrainBurkholderia xenovorans LB400
Repliconchromosome 1 [GenBank: NC_007951] [Browse all T4SS(s) in this replicon]
Location [Strand]2964730..2965848 [-]
Producttype IV secretion system protein VirB11
Component typeVirB11
UniProt IDQ13XJ4
KEGG IDbxe:Bxe_A1762
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.1e-61, Aligned region: 31..338
Protein Sequence: 372 a.a.     [Download]
>gi|91784041|ref|YP_559247.1| type IV secretion system protein VirB11 [Burkholderia xenovorans LB400]
MTFRPDTSDSPHDPMLARLPDDASVRELMRPFAPLLEDADVTELVINRPQRVLTENARGWHGHDCVDLDF
DRLMSFAVAVATLTNQEISAQHPVLSALLPGDARIQIVVPPVVPPRTVSITIRRPSAREKSLDAYRDEGL
FDDTVWHRPDGLDAALPVLRAEDHRLVRCLEEHDWGAFFGRAVTDRLNLVVVGNTGSGKTSFMKTLCRSI
PATERIVTIEDVRELFIRHIENCVHLLYSKGGQGQARVTPADLIASTMRMRPDRVLLAELRGAEAYDFLK
LLTTGHAGSITSYHAPNAAVAIERFALMAKEHPEAAAWDDAALKRLLFLTIDVVAHMEAQPVFDVAGEQT
GKRWRMTEVWFDPVRKARTAFV
 
Nucleotide Sequence: 1119 bp     [Download]
>gi|91781384|ref|NC_007951.1|:c2965848-2964730 Burkholderia xenovorans LB400 chromosome 1, complete sequence
ATGACGTTCCGCCCTGATACGTCGGATTCGCCCCACGATCCCATGCTGGCTCGTCTGCCCGACGATGCTT
CCGTACGTGAGCTGATGCGTCCGTTCGCGCCGCTGCTCGAGGACGCCGACGTGACGGAACTCGTGATCAA
CCGGCCGCAGCGCGTCCTGACCGAGAACGCGCGTGGCTGGCACGGTCACGACTGCGTGGACCTCGATTTC
GACCGGCTGATGTCATTCGCGGTAGCGGTCGCCACGCTGACGAACCAGGAGATCTCGGCCCAGCATCCGG
TCCTGTCCGCGTTGCTGCCAGGCGACGCGCGCATCCAGATTGTGGTGCCGCCGGTCGTGCCGCCGCGCAC
CGTCTCCATCACGATCCGCCGGCCGTCCGCGCGCGAAAAAAGCCTCGATGCCTATCGCGACGAAGGTCTG
TTCGACGACACGGTATGGCATCGCCCGGACGGGCTCGATGCGGCGCTGCCGGTGCTGCGCGCAGAGGACC
ACCGTCTCGTCCGGTGTTTGGAAGAGCACGACTGGGGTGCCTTCTTCGGTCGTGCGGTGACGGACCGGCT
CAATCTCGTGGTCGTCGGCAACACGGGGTCGGGCAAGACCAGTTTCATGAAAACCCTGTGCCGTTCGATT
CCGGCGACCGAGCGGATCGTGACGATCGAGGACGTCCGCGAGCTGTTCATCCGGCACATCGAGAACTGCG
TCCACCTGCTGTACAGCAAAGGCGGGCAGGGCCAGGCGCGCGTCACGCCCGCCGATCTCATCGCCAGCAC
CATGCGCATGCGTCCCGATCGCGTGTTGCTCGCCGAGCTGCGCGGTGCCGAAGCCTACGATTTCCTGAAG
CTGCTGACGACGGGCCACGCCGGCTCGATCACGAGTTACCACGCGCCCAATGCCGCGGTGGCGATCGAGC
GTTTCGCGCTGATGGCGAAGGAACACCCCGAGGCTGCTGCCTGGGACGATGCCGCGCTCAAGCGCCTGCT
GTTCCTGACGATCGACGTTGTCGCGCACATGGAGGCGCAGCCCGTATTCGACGTTGCGGGCGAGCAGACC
GGCAAACGCTGGCGCATGACTGAAGTCTGGTTCGATCCAGTGCGCAAGGCGCGCACCGCGTTCGTCTAG
 Primer design