SecReT4
Protein ID: 91784044
T4SS name [ID]VirB [365]
Gene symbol-
Locus tagBxe_A1759
StrainBurkholderia xenovorans LB400
Repliconchromosome 1 [GenBank: NC_007951] [Browse all T4SS(s) in this replicon]
Location [Strand]2967900..2968619 [-]
Producttype IV secretion system protein VirB8/TraJ
Component typeVirB8
UniProt IDQ13XJ1
KEGG IDbxe:Bxe_A1759
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4.3e-52, Aligned region: 12..220
Protein Sequence: 239 a.a.     [Download]
>gi|91784044|ref|YP_559250.1| type IV secretion system protein VirB8/TraJ [Burkholderia xenovorans LB400]
MSAQHNYERVLDIEASLTYLQERSERRAWHVAYAAVGVAVLSVAALAVMVPFYRVVPLPIEVDRLTGESQ
VIDVLDARHVHTKEIQDKHWVETYVRERERYDWGLLQMDYDSVLAMSDDVVARDYRGIYSGSDALDRQLG
AGTERRVRILSVTLPPDEPGHAVVHVERTTFRNGQADAEPTQRFVITLAYTYRPPVFTRESVAIANPFGF
KVTAYSRDPEYTPPASAAASATTTAGGTP
 
Nucleotide Sequence: 720 bp     [Download]
>gi|91781384|ref|NC_007951.1|:c2968619-2967900 Burkholderia xenovorans LB400 chromosome 1, complete sequence
ATGAGCGCGCAGCACAACTACGAGCGTGTGCTCGACATCGAGGCGTCGCTGACCTACCTGCAGGAACGTT
CCGAGCGGCGCGCGTGGCATGTCGCCTATGCCGCGGTCGGTGTGGCCGTGCTGAGTGTTGCCGCTCTCGC
GGTGATGGTGCCGTTCTACCGCGTGGTGCCCTTGCCGATCGAGGTCGATCGCCTGACGGGCGAGTCCCAG
GTCATCGATGTACTCGATGCACGCCATGTGCATACGAAGGAGATCCAGGACAAGCACTGGGTCGAGACCT
ATGTGCGCGAGCGCGAACGCTACGACTGGGGCCTGCTGCAGATGGACTACGATAGCGTGCTCGCGATGAG
CGATGACGTGGTCGCACGCGACTACCGCGGCATCTATAGCGGCTCCGATGCACTCGACCGGCAACTCGGG
GCGGGCACCGAGCGGCGCGTGCGGATTCTCTCGGTCACGCTGCCGCCCGATGAACCGGGGCACGCGGTCG
TGCATGTCGAGCGCACGACGTTCAGGAACGGCCAGGCCGATGCCGAGCCGACGCAGCGTTTCGTGATCAC
GCTGGCCTATACCTACAGGCCGCCTGTGTTTACGCGCGAGAGCGTGGCCATCGCCAATCCGTTCGGCTTC
AAGGTCACGGCCTACAGCCGCGATCCCGAATATACGCCGCCGGCATCGGCTGCGGCATCCGCGACCACGA
CTGCGGGAGGCACGCCATGA
 Primer design