SecReT4
Protein ID: 91784605
T4SS name [ID]Tfc [704]
Gene symbol-
Locus tagBxe_A1194
StrainBurkholderia xenovorans LB400
Repliconchromosome 1 [GenBank: NC_007951] [Browse all T4SS(s) in this replicon]
Location [Strand]3595127..3595876 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDQ13VY0
KEGG IDbxe:Bxe_A1194
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 1.4e-70, Aligned region: 46..246
Protein Sequence: 249 a.a.     [Download]
>gi|91784605|ref|YP_559811.1| hypothetical protein Bxe_A1194 [Burkholderia xenovorans LB400]
MKDAASTAQREQNQRQGLIVGTITLPFRLLGVLIGSLLFSIVVECVGMHLFWKDQGWRHSQQMLQYELGH
LSNHFTRSVVVREPGRTAHELVDTGYEWVFVRSGLLERMSQTAERARAPSHGQTRNFRYYISQVYVWTES
YLIAAAFTTLTFLVRLLVLVLTLPLISTAAFVGLIDGLVRRDVRRFGAGRESGFIYHRAKASLMPIAVLP
WVTYLALPISVHPLLILLPSAALLGLAVSLTAGSFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|91781384|ref|NC_007951.1|:3595127-3595876 Burkholderia xenovorans LB400 chromosome 1, complete sequence
ATGAAGGATGCCGCCTCGACCGCGCAGCGGGAGCAGAACCAGCGCCAAGGCCTGATCGTCGGCACCATCA
CCTTGCCGTTCCGGCTGCTCGGGGTGCTGATCGGCTCACTGCTGTTCTCCATCGTCGTGGAATGCGTCGG
CATGCACCTGTTCTGGAAGGACCAGGGCTGGCGTCACTCCCAGCAGATGTTGCAGTACGAGCTGGGGCAC
CTGTCCAACCACTTCACGCGCAGCGTCGTCGTGCGGGAGCCAGGGCGCACGGCGCATGAGCTGGTGGACA
CCGGCTACGAATGGGTATTCGTGCGCTCGGGACTGCTGGAACGCATGAGCCAGACCGCCGAGCGTGCCCG
TGCGCCCAGCCACGGGCAGACGCGCAACTTCCGCTATTACATCAGCCAGGTCTATGTCTGGACCGAGAGC
TACCTGATCGCCGCGGCCTTCACGACGCTGACCTTCCTTGTGCGCCTGCTGGTCCTTGTGCTCACGTTGC
CGCTGATCTCCACTGCGGCGTTCGTCGGCCTGATCGACGGCTTGGTGCGCAGGGACGTGCGCCGGTTCGG
CGCGGGCCGCGAATCGGGTTTCATCTACCACCGTGCGAAAGCCAGCCTGATGCCCATAGCCGTTCTGCCC
TGGGTCACGTACCTGGCCTTGCCGATCTCGGTACACCCATTACTGATCCTCTTGCCGAGCGCCGCCTTGC
TGGGACTGGCGGTGTCTCTGACTGCGGGGAGCTTCAAAAAGTACCTGTGA
 Primer design