SecReT4
Protein ID: 91784607
T4SS name [ID]Tfc [704]
Gene symbol-
Locus tagBxe_A1192
StrainBurkholderia xenovorans LB400
Repliconchromosome 1 [GenBank: NC_007951] [Browse all T4SS(s) in this replicon]
Location [Strand]3596503..3596886 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDQ13VX8
KEGG IDbxe:Bxe_A1192
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 5.7e-29, Aligned region: 31..109
Protein Sequence: 127 a.a.     [Download]
>gi|91784607|ref|YP_559813.1| hypothetical protein Bxe_A1192 [Burkholderia xenovorans LB400]
MVALTWLRAAHRGVPTFLVMALLLGQSPMALGESPAQRQELVAALRQLDALERTVADSAAHASIQPGERY
HFDYPRLLADLARMRAGIQAHLTPSRAQPRDTSELAGGYRTERAVEGSLPTTVENKP
 
Nucleotide Sequence: 384 bp     [Download]
>gi|91781384|ref|NC_007951.1|:3596503-3596886 Burkholderia xenovorans LB400 chromosome 1, complete sequence
ATGGTGGCTTTAACCTGGCTGCGCGCCGCGCATCGCGGCGTGCCCACTTTTCTCGTGATGGCCCTCCTGC
TGGGCCAGTCCCCGATGGCGTTGGGCGAGTCCCCGGCGCAGCGCCAGGAGTTGGTCGCCGCGCTGCGCCA
GCTCGACGCGCTGGAGCGCACCGTCGCCGACAGCGCCGCGCATGCCTCCATCCAGCCGGGCGAACGCTAT
CACTTCGATTACCCGCGGCTGCTGGCTGATCTAGCGCGTATGCGCGCTGGCATCCAGGCCCACCTTACCC
CGTCGCGTGCCCAGCCGCGCGACACCTCCGAACTGGCCGGCGGCTACCGCACCGAGCGGGCCGTCGAGGG
ATCGCTGCCGACGACTGTGGAGAACAAGCCATGA
 Primer design