SecReT4
Protein ID: 91784610
T4SS name [ID]Tfc [704]
Gene symbol-
Locus tagBxe_A1189
StrainBurkholderia xenovorans LB400
Repliconchromosome 1 [GenBank: NC_007951] [Browse all T4SS(s) in this replicon]
Location [Strand]3597505..3597915 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDQ13VX5
KEGG IDbxe:Bxe_A1189
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 4.7e-49, Aligned region: 10..133
Protein Sequence: 136 a.a.     [Download]
>gi|91784610|ref|YP_559816.1| hypothetical protein Bxe_A1189 [Burkholderia xenovorans LB400]
MSEQQHVRADGTVTFLPHRLNRHPVVVRGLTADELWICCGLSGAAGLLVGAPLSWVFRTIALAPTFVVLG
VAFGVFIGGGILRRLKRGRPDTWLYRQLQWRIATRHPLVAGWVGGHVLISRSGFWTTRRSAARGSR
 
Nucleotide Sequence: 411 bp     [Download]
>gi|91781384|ref|NC_007951.1|:3597505-3597915 Burkholderia xenovorans LB400 chromosome 1, complete sequence
ATGTCCGAGCAGCAGCACGTCCGTGCTGACGGGACGGTCACGTTCCTTCCGCACCGGCTCAACCGCCATC
CCGTTGTTGTGCGCGGCCTCACCGCCGACGAGCTGTGGATCTGCTGCGGCCTGTCCGGCGCCGCCGGCCT
GCTGGTCGGTGCGCCGCTGTCCTGGGTGTTCCGCACGATCGCGCTTGCACCCACGTTCGTCGTGCTGGGC
GTGGCCTTCGGCGTGTTCATCGGGGGCGGCATCCTGCGTCGCCTCAAGCGTGGGCGTCCCGACACCTGGC
TGTATCGGCAACTCCAGTGGCGCATCGCCACGCGCCACCCGCTGGTGGCAGGCTGGGTGGGCGGCCATGT
ACTGATCTCACGCTCCGGCTTCTGGACCACCCGAAGGTCTGCAGCAAGGGGGTCACGATGA
 Primer design