SecReT4
Protein ID: 91784620
T4SS name [ID]Tfc [704]
Gene symbol-
Locus tagBxe_A1179
StrainBurkholderia xenovorans LB400
Repliconchromosome 1 [GenBank: NC_007951] [Browse all T4SS(s) in this replicon]
Location [Strand]3607244..3608641 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDQ13VW5
KEGG IDbxe:Bxe_A1179
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 465 a.a.     [Download]
>gi|91784620|ref|YP_559826.1| hypothetical protein Bxe_A1179 [Burkholderia xenovorans LB400]
MKFRPAFNPFSPRVPRTKIVLALAGALALASGVAWGQLGYQTGGSVIGDDVMYSIGGGSAVSMGRAAGMQ
SIGVGVGWNSNLVCGDMSLQTTLRNQLNGITNGFQQIMGNVIQSATSAVASLPALIIQRADPGLYNLLTN
GVLQARLDFDRSKLTCRAMAEKMADTAGGQLGWSRMAEGLALRDAVSSTDAVSAIEQAETRRGNDGVPWV
GGSNAGGSGQPAIKVVGDVTRAGYNLVNGRGVTDTSSIAPTSCSSLSCQTWTSPQAAVEWATRVLGEKEQ
RTCDACTKTETTPGVGLTPLIQEEYDAKLQALQDLVSKAKNTTPENLREAGSASLPITRGVIEALRDEPD
QHLLSQRLASEVALSSVLEKALLLQRTLLTGKKEPNVAANELAVESVNKESDTLDREIRNLKTELELRRE
LANNSPMAIIQRHGTRAAGSRGIYEGDPIPDRLDRLQKGNPGGNP
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|91781384|ref|NC_007951.1|:3607244-3608641 Burkholderia xenovorans LB400 chromosome 1, complete sequence
ATGAAGTTTCGTCCTGCATTCAATCCGTTCTCCCCCCGTGTACCTCGCACGAAGATCGTTCTGGCGCTGG
CTGGTGCGCTGGCCTTGGCCAGCGGCGTGGCCTGGGGCCAACTGGGCTACCAGACGGGCGGCAGCGTCAT
CGGCGATGACGTCATGTACTCCATCGGTGGCGGCAGCGCAGTGTCCATGGGACGTGCCGCAGGAATGCAA
TCGATCGGCGTGGGCGTGGGCTGGAACTCAAATCTCGTCTGCGGCGACATGAGCCTCCAGACCACTCTGC
GCAACCAGCTCAACGGCATCACGAACGGCTTTCAGCAGATCATGGGGAACGTGATCCAGAGCGCCACCAG
CGCCGTGGCATCCCTGCCTGCGCTGATCATTCAGCGCGCCGACCCGGGCTTGTACAACCTGCTCACCAAT
GGCGTGCTGCAAGCGCGGCTGGATTTCGACCGTTCCAAGCTGACGTGCCGCGCAATGGCCGAGAAGATGG
CCGACACAGCGGGCGGCCAGCTCGGCTGGAGCCGGATGGCAGAAGGTTTGGCGCTGCGCGATGCGGTGTC
AAGCACGGATGCGGTCTCGGCCATCGAGCAGGCCGAAACGCGCCGCGGCAATGACGGTGTGCCGTGGGTC
GGGGGTAGCAACGCGGGGGGCTCTGGTCAGCCCGCGATTAAGGTCGTCGGCGATGTCACCCGCGCCGGCT
ACAACCTAGTCAACGGCCGCGGCGTGACCGATACGTCGTCTATCGCACCGACCAGTTGTAGCAGCCTCTC
GTGCCAGACCTGGACCTCGCCGCAGGCCGCCGTCGAGTGGGCCACGCGCGTACTCGGCGAGAAGGAACAG
CGCACTTGCGATGCCTGCACCAAAACCGAGACGACGCCCGGCGTAGGACTGACGCCGCTGATCCAGGAAG
AGTACGACGCCAAGCTGCAGGCGCTCCAGGATCTGGTGTCCAAGGCGAAGAACACGACGCCCGAGAACCT
GCGCGAAGCTGGCAGTGCATCGCTGCCCATCACCCGCGGCGTCATCGAGGCGCTGCGCGACGAGCCGGAC
CAGCACCTGCTGTCGCAGCGCCTGGCGTCCGAGGTCGCGCTGTCCTCAGTGCTGGAGAAGGCGCTGCTGC
TACAGCGCACGCTGCTCACGGGCAAGAAAGAGCCCAACGTCGCGGCCAACGAGCTTGCGGTGGAGAGCGT
GAACAAGGAGAGCGATACGCTCGACCGCGAAATCCGCAACCTCAAGACCGAACTGGAGCTACGGCGCGAA
CTGGCGAATAACTCGCCCATGGCCATCATCCAGCGGCATGGCACGCGTGCGGCAGGCTCGCGCGGCATCT
ACGAGGGCGATCCCATCCCCGACCGTCTCGACCGGCTCCAGAAGGGCAATCCGGGAGGCAACCCATGA
 Primer design