SecReT4
Protein ID: 91791035
T4SS name [ID]Trb [771]
Gene symbol-
Locus tagBpro_5227
StrainPolaromonas sp. JS666
Repliconplasmid 1 [GenBank: NC_007949] [Browse all T4SS(s) in this replicon]
Location [Strand]335625..336008 [+]
Producthypothetical protein
Component typeTrbC
UniProt IDQ120F4
KEGG IDpol:Bpro_5227
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 6.1e-08, Aligned region: 22..105
Protein Sequence: 127 a.a.     [Download]
>gi|91791035|ref|YP_551986.1| hypothetical protein Bpro_5227 [Polaromonas sp. JS666]
MIQTIKSKITALRQNQSGGQNLKTVLTATLVAALLAVMPIDAMAQNFDIPFITQFGCSVVKWMKGPLAIL
IFVVVVIATLVIGMISKMDWSRIISVCVVFGIIIGLGGVLANSSYFQAMPAMQSCLS
 
Nucleotide Sequence: 384 bp     [Download]
>gi|91790731|ref|NC_007949.1|:335625-336008 Polaromonas sp. JS666 plasmid 1, complete sequence
ATGATCCAAACCATCAAATCCAAAATTACCGCGCTGCGCCAGAACCAGTCGGGCGGCCAGAACCTGAAGA
CGGTTTTGACTGCCACCCTGGTAGCGGCCCTGCTCGCTGTCATGCCCATTGATGCCATGGCCCAAAACTT
CGACATTCCATTCATCACGCAGTTTGGCTGCTCCGTGGTGAAGTGGATGAAGGGACCATTGGCGATTCTG
ATCTTCGTTGTCGTCGTGATCGCTACGCTGGTGATCGGGATGATTTCCAAGATGGACTGGAGTCGCATTA
TTTCCGTGTGTGTGGTGTTCGGCATCATCATCGGTCTGGGCGGTGTACTGGCTAATTCGTCGTACTTCCA
AGCCATGCCCGCAATGCAATCCTGCTTGTCCTAA
 Primer design