SecReT4
Protein ID: 91791044
T4SS name [ID]Trb [771]
Gene symbol-
Locus tagBpro_5236
StrainPolaromonas sp. JS666
Repliconplasmid 1 [GenBank: NC_007949] [Browse all T4SS(s) in this replicon]
Location [Strand]345269..346141 [+]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDQ120E5
KEGG IDpol:Bpro_5236
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.6e-61, Aligned region: 33..273
Protein Sequence: 290 a.a.     [Download]
>gi|91791044|ref|YP_551995.1| conjugal transfer protein TrbG/VirB9/CagX [Polaromonas sp. JS666]
MIIRHLALVAAVSLTGFVGLSHAELIATPLTGDTRLVQFTYDEDNTFLVLAKPKAVTHLQFATDEMLQSV
ASGDTAQWELTPTKNRKNLFIKPKFEGIETSMTVITDKRTYQFVLRSTADGKKWYQRVSWMYSSSLVLEQ
DALLDAQANVPMSGGLPEPVQSSGIRPLQPTFNLPPLNSAGGSSTTLKPDSLRFNYKVDGDAAFKPTQVF
DDGKFTYLRMPQDVQELPALFAVIEGQEYSLVNYTVDGSYMVAQRLLENAVLKLGKSEVQVTKVKPAGGF
MGFMGGDSAK
 
Nucleotide Sequence: 873 bp     [Download]
>gi|91790731|ref|NC_007949.1|:345269-346141 Polaromonas sp. JS666 plasmid 1, complete sequence
ATGATCATTCGGCATTTGGCGCTAGTAGCCGCTGTTTCGCTAACTGGTTTTGTGGGTCTATCCCATGCGG
AACTGATCGCAACCCCTCTGACAGGCGATACGCGCCTGGTGCAGTTTACCTACGACGAAGACAACACCTT
TCTGGTGCTTGCTAAGCCAAAGGCCGTGACCCATCTGCAGTTTGCTACAGATGAAATGCTGCAGTCAGTT
GCTTCGGGTGATACCGCGCAATGGGAACTCACCCCCACGAAGAACCGGAAAAACCTGTTCATCAAGCCAA
AATTCGAAGGCATCGAGACTTCGATGACGGTGATCACTGACAAGCGCACCTATCAGTTTGTGCTGCGCTC
AACGGCGGACGGCAAGAAGTGGTACCAGCGGGTGTCCTGGATGTACTCATCCAGTCTGGTACTGGAACAA
GATGCCTTGCTGGATGCACAAGCGAACGTGCCCATGTCTGGTGGATTGCCTGAACCAGTCCAAAGCAGCG
GCATTCGCCCACTCCAGCCAACATTCAACCTTCCCCCCCTGAATTCTGCCGGCGGATCTTCCACCACGTT
GAAGCCTGACTCTTTGCGCTTCAATTACAAGGTCGATGGTGACGCTGCATTCAAACCCACACAGGTCTTT
GACGACGGCAAGTTCACCTACCTGCGCATGCCACAGGATGTGCAGGAGCTGCCAGCTCTCTTCGCTGTGA
TTGAGGGGCAAGAATATTCCCTGGTGAACTACACGGTCGATGGCAGCTACATGGTTGCACAACGTCTGCT
CGAAAACGCCGTTCTCAAGCTGGGCAAGAGTGAAGTGCAGGTTACCAAGGTCAAGCCTGCTGGTGGCTTT
ATGGGCTTCATGGGTGGGGACAGCGCCAAATGA
 Primer design