SecReT4
Protein ID: 91791257
T4SS name [ID]Trb [772]
Gene symbol-
Locus tagBpro_5455
StrainPolaromonas sp. JS666
Repliconplasmid 2 [GenBank: NC_007950] [Browse all T4SS(s) in this replicon]
Location [Strand]207754..209022 [-]
Productconjugation TrbI-like protein
Component typeTrbI
UniProt IDQ11ZI3
KEGG IDpol:Bpro_5455
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.3e-52, Aligned region: 237..416
Protein Sequence: 422 a.a.     [Download]
>gi|91791257|ref|YP_552207.1| conjugation TrbI-like protein [Polaromonas sp. JS666]
MADNLLSPKTTAPTGVPPKNILAFLGIGILLAIGCYSWYSDVSTPTKGEDASKKVTLQEATAAKDAGVKG
DPKDVTAFADKAGVPAALRGDAAAKAPLPSASAPDTGVRPQPFPVDLGSPPASSKLGTAASLEAVRETEI
SNAKPVVFDQALAPAQAPSEKLDPISQLIEQEKIAQARREAASAKAGDLSQVSGLLNSQRPQQAPAGRAA
DKSWLKEFAPSRKDPGLLPSLPEAPLMLTQGSVIEAVTLREINSDLPGVITARTTRDIYDSTTQRNLVLP
KGTLAIGEYSSDVRMGQERLLFAFTRLVLPNGQSFDLGSFNGGDAAGRAGVKGDVDNHYFRLFGTSLLIG
LLADRVVSTKAVPQGTNGQAGGLSATGQILTDTAKSILERNREVAPTISIPSGARVVIEVRRDMLFPSPF
RG
 
Nucleotide Sequence: 1269 bp     [Download]
>gi|91791058|ref|NC_007950.1|:c209022-207754 Polaromonas sp. JS666 plasmid 2, complete sequence
ATGGCCGATAACCTCCTTTCCCCCAAAACCACCGCGCCGACGGGCGTCCCGCCCAAGAACATCTTGGCGT
TTTTGGGTATTGGCATCCTATTGGCCATTGGCTGCTATTCGTGGTACAGCGACGTTTCTACACCTACGAA
AGGTGAGGACGCTAGCAAAAAGGTCACGTTGCAGGAAGCAACCGCGGCAAAAGACGCTGGCGTCAAGGGC
GACCCGAAGGATGTGACCGCATTTGCTGACAAGGCGGGTGTGCCAGCTGCGCTTCGCGGAGACGCGGCCG
CCAAGGCACCGCTGCCCAGCGCTTCAGCTCCTGACACGGGTGTGCGGCCGCAGCCGTTCCCGGTCGATCT
TGGCAGTCCGCCGGCGAGCTCCAAACTTGGCACTGCGGCTTCACTAGAAGCCGTCCGCGAGACAGAGATT
TCCAATGCCAAGCCGGTGGTATTTGACCAGGCGCTCGCGCCGGCACAAGCTCCCTCCGAGAAGCTGGACC
CGATTTCCCAACTCATCGAACAGGAAAAGATCGCGCAGGCGCGAAGGGAAGCAGCGTCGGCTAAAGCAGG
AGATCTGTCCCAGGTCTCGGGCCTTCTCAATTCTCAGCGGCCGCAGCAGGCCCCCGCTGGCCGTGCAGCA
GACAAGTCTTGGTTGAAAGAATTCGCCCCTTCACGGAAAGACCCTGGTCTTCTTCCGTCGCTCCCTGAAG
CACCTTTGATGCTGACTCAAGGTAGCGTGATCGAGGCTGTGACACTTCGGGAGATCAACAGCGACCTCCC
GGGCGTCATCACCGCGCGCACCACGCGCGACATCTATGACTCCACTACCCAGCGCAACCTGGTATTGCCG
AAGGGCACGCTGGCAATTGGCGAATACTCATCGGACGTGCGCATGGGCCAGGAACGGCTGTTGTTTGCTT
TCACCCGGCTTGTGCTTCCCAACGGTCAGTCGTTCGATCTTGGATCCTTCAACGGCGGGGATGCAGCCGG
CCGAGCGGGGGTGAAAGGCGACGTTGACAACCACTATTTTCGCTTGTTTGGAACAAGCCTCCTGATCGGT
CTTCTGGCAGACCGCGTCGTATCGACGAAGGCCGTTCCACAGGGAACCAATGGTCAAGCCGGCGGGCTGT
CGGCGACCGGCCAGATCCTGACCGACACCGCGAAGTCCATTCTTGAGCGGAACCGCGAAGTGGCACCGAC
CATCAGCATCCCCTCGGGCGCGAGGGTCGTTATTGAAGTCCGGCGCGACATGCTTTTCCCTTCTCCCTTT
CGAGGTTAG
 Primer design