SecReT4
Protein ID: 91791258
T4SS name [ID]Trb [772]
Gene symbol-
Locus tagBpro_5456
StrainPolaromonas sp. JS666
Repliconplasmid 2 [GenBank: NC_007950] [Browse all T4SS(s) in this replicon]
Location [Strand]209012..209818 [-]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDQ11ZI2
KEGG IDpol:Bpro_5456
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 7.7e-53, Aligned region: 32..255
Protein Sequence: 268 a.a.     [Download]
>gi|91791258|ref|YP_552208.1| conjugal transfer protein TrbG/VirB9/CagX [Polaromonas sp. JS666]
MRFLAAAIATCLFHLAGPAANAQQIATPVNGDTRLVTFDFDPDVTYLILTRPKSVTDVMLAPGEQVLSLV
AGDTVNFVFQVSASREHIFIKPKFEGLTTSASLVTNKTTYQLILRSANETGKWHQRVTWNNPEMVLQDVA
ASSRGAPQREIAAQSEQPVRVAGGGESALAIDKLQFNYLITGTDAIKPSQVFDDGIRTYFRIPEGMQEMP
ALFTLKDSEASLVNYAVKDGYLIAQGVGGIFLLKLGKQEVRVEKEGRRNFFGGLINGR
 
Nucleotide Sequence: 807 bp     [Download]
>gi|91791058|ref|NC_007950.1|:c209818-209012 Polaromonas sp. JS666 plasmid 2, complete sequence
ATGAGATTTCTAGCTGCAGCCATCGCGACGTGTCTGTTCCACTTGGCTGGGCCAGCTGCCAATGCCCAGC
AGATCGCCACTCCTGTGAATGGCGACACACGCTTGGTGACATTCGACTTCGACCCAGATGTCACGTACTT
GATTCTTACGCGCCCCAAATCAGTCACAGACGTGATGCTTGCACCAGGGGAACAGGTCCTTTCACTTGTC
GCCGGCGACACGGTCAACTTTGTATTTCAGGTGTCCGCGAGCCGCGAGCACATCTTCATCAAGCCAAAGT
TTGAAGGACTGACGACCAGCGCTAGCCTGGTGACGAACAAAACCACCTATCAACTCATTCTTCGAAGCGC
GAATGAGACTGGGAAGTGGCACCAACGAGTCACATGGAACAACCCTGAGATGGTCCTTCAGGATGTAGCG
GCCTCCTCAAGAGGCGCGCCGCAGAGGGAGATAGCCGCGCAGTCTGAACAGCCCGTCCGCGTTGCAGGCG
GCGGCGAGTCAGCGCTTGCGATCGACAAGCTCCAGTTCAATTACCTCATCACTGGGACCGACGCCATCAA
ACCATCGCAGGTCTTCGATGACGGAATACGGACCTATTTCCGGATCCCTGAGGGTATGCAGGAAATGCCC
GCACTGTTCACCCTCAAGGACAGCGAAGCTTCACTGGTGAACTACGCTGTCAAGGACGGCTACCTGATAG
CCCAGGGCGTGGGCGGGATCTTCTTGCTCAAGTTGGGTAAGCAGGAAGTGCGCGTGGAAAAAGAGGGGCG
CCGGAACTTCTTCGGTGGATTGATCAATGGCCGATAA
 Primer design