SecReT4
Protein ID: 91791259
T4SS name [ID]Trb [772]
Gene symbol-
Locus tagBpro_5457
StrainPolaromonas sp. JS666
Repliconplasmid 2 [GenBank: NC_007950] [Browse all T4SS(s) in this replicon]
Location [Strand]209815..210585 [-]
ProductType IV secretory pathway component VirB8-like
Component typeTrbF
UniProt IDQ11ZI1
KEGG IDpol:Bpro_5457
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.1e-30, Aligned region: 50..250
Protein Sequence: 256 a.a.     [Download]
>gi|91791259|ref|YP_552209.1| Type IV secretory pathway component VirB8-like [Polaromonas sp. JS666]
MRFRAQKGTKLRIGAYFSEIFDAFAFYSEGMFGKKPPSLLNTPPIAEIDASRKFSELYGNAATHGSRWFV
VAVFLLFMNILQSFSLAFLIPLKQVVVYLVETNSEKLLVAQPFKAEQFRPDARFVKAEARNYIRNLMTID
PYLTRGNFETAMGRSSDKAIGKVKDLIASDQPFERLAKQPGLVREAIVSSVDTSQPGLIFATVTTNERIS
QNPPIVENWRFTIHYKTVPPESEAQLMDNPLGITFSYFERFKEGVK
 
Nucleotide Sequence: 771 bp     [Download]
>gi|91791058|ref|NC_007950.1|:c210585-209815 Polaromonas sp. JS666 plasmid 2, complete sequence
TTGCGTTTTCGGGCCCAGAAAGGGACAAAACTGCGAATTGGGGCCTATTTCTCCGAAATTTTTGATGCAT
TTGCTTTTTACAGTGAGGGCATGTTCGGAAAAAAGCCCCCCTCTTTGCTCAACACCCCACCGATCGCTGA
GATAGATGCTTCCCGCAAATTCTCTGAGCTCTATGGGAACGCCGCGACACACGGCTCGCGATGGTTCGTG
GTGGCCGTGTTCCTGCTTTTCATGAACATCCTCCAGTCGTTCTCGCTCGCGTTCCTCATTCCTCTCAAGC
AGGTCGTTGTTTACCTTGTTGAGACCAACTCGGAAAAACTCCTGGTCGCGCAGCCGTTCAAAGCTGAACA
GTTCCGGCCGGACGCGCGTTTCGTCAAGGCAGAGGCGAGGAACTATATCCGCAACCTGATGACGATCGAC
CCCTACCTCACCAGGGGCAACTTTGAAACCGCCATGGGTCGCTCCAGTGACAAAGCCATCGGTAAAGTCA
AAGACCTAATTGCAAGTGACCAGCCCTTCGAGCGCTTAGCCAAGCAGCCCGGGCTTGTCCGTGAGGCAAT
CGTTTCTTCCGTGGACACCTCGCAGCCGGGCCTGATCTTTGCGACTGTGACCACCAACGAGCGGATCAGC
CAGAACCCGCCCATCGTGGAGAACTGGCGCTTCACCATCCACTACAAAACCGTCCCTCCGGAGTCTGAGG
CCCAACTTATGGACAACCCACTCGGCATCACCTTTTCGTACTTCGAGCGCTTCAAAGAGGGTGTGAAATG
A
 Primer design