SecReT4
Protein ID: 91791266
T4SS name [ID]Trb [772]
Gene symbol-
Locus tagBpro_5464
StrainPolaromonas sp. JS666
Repliconplasmid 2 [GenBank: NC_007950] [Browse all T4SS(s) in this replicon]
Location [Strand]215686..216561 [-]
Producthypothetical protein
Component typeTrbJ
UniProt IDQ11ZH4
KEGG IDpol:Bpro_5464
PDB IDNA
Domain hit(s) vs Pfam DUF4141 [PF13605], Evalue: 1.4e-06, Aligned region: 18..62
Protein Sequence: 291 a.a.     [Download]
>gi|91791266|ref|YP_552216.1| hypothetical protein Bpro_5464 [Polaromonas sp. JS666]
MKFIRFTKTAKSCLFSALVLIGASMPGVSGAQWIVFDPTSFIQSAITAAESVTGTAQRAQAYVAQLQQYK
TMLINLKQLPQGALNSALGSLTQGQTELMKNMGGLEKIRDIGSISNEIGRISGSITSAKSSVTSLIALQQ
SMGGLQESYSKRFEEARRLNLTWEQYAAQEDLQIRSRVSSAAARAQEDINRVERVKRDYEFAQDMAQKIP
EAEGVQQSMAIMNTQMNRVVTQLAEVNKGLTSAMNSKSPDDVMAEEQAKQRAADDRRTRLKNIETQRKAD
EDAFKAWRKEQ
 
Nucleotide Sequence: 876 bp     [Download]
>gi|91791058|ref|NC_007950.1|:c216561-215686 Polaromonas sp. JS666 plasmid 2, complete sequence
ATGAAATTTATACGCTTTACCAAGACAGCCAAATCATGCCTGTTCTCTGCGCTTGTGCTCATCGGAGCGT
CGATGCCGGGCGTCTCCGGTGCGCAATGGATCGTCTTCGACCCAACCAGCTTCATACAGAGCGCGATCAC
GGCAGCTGAGTCGGTCACGGGAACGGCGCAGCGCGCACAGGCCTACGTCGCGCAGTTGCAGCAGTATAAG
ACGATGCTTATCAACCTCAAGCAGCTTCCGCAGGGTGCGCTCAATAGCGCCCTAGGTTCTCTCACGCAGG
GACAGACCGAGCTGATGAAGAATATGGGCGGCCTTGAAAAAATTCGTGACATCGGATCCATCTCTAACGA
GATTGGCCGTATTTCAGGATCGATCACAAGCGCGAAGTCCAGCGTGACCTCGCTCATCGCGTTGCAACAA
AGTATGGGCGGCCTTCAAGAATCCTATTCAAAGCGATTCGAAGAGGCCCGGCGACTGAACTTGACCTGGG
AACAATACGCAGCCCAAGAGGACCTACAGATCCGTTCACGAGTCTCCTCGGCCGCTGCACGTGCCCAAGA
GGACATCAATCGGGTGGAACGGGTGAAACGTGACTACGAATTTGCACAGGACATGGCGCAGAAAATACCG
GAAGCTGAGGGCGTGCAGCAGTCGATGGCGATCATGAATACGCAGATGAACCGTGTGGTTACGCAGCTGG
CGGAGGTCAACAAGGGCCTGACCTCTGCAATGAACTCTAAGTCCCCGGATGACGTCATGGCAGAGGAGCA
GGCGAAGCAGCGCGCAGCCGACGACCGGCGCACCCGGCTGAAGAATATTGAGACACAGCGTAAGGCAGAT
GAGGATGCATTCAAGGCTTGGAGAAAAGAGCAATGA
 Primer design