SecReT4
Protein ID: 91791267
T4SS name [ID]Trb [772]
Gene symbol-
Locus tagBpro_5465
StrainPolaromonas sp. JS666
Repliconplasmid 2 [GenBank: NC_007950] [Browse all T4SS(s) in this replicon]
Location [Strand]216575..219127 [-]
ProductType IV secretory pathway VirB4 components-like
Component typeTrbE
UniProt IDQ11ZH3
KEGG IDpol:Bpro_5465
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.7e-29, Aligned region: 482..778
CagE_TrbE_VirB [PF03135], Evalue: 2.4e-11, Aligned region: 209..327
CagE_TrbE_VirB [PF03135], Evalue: 2.4e-11, Aligned region: 327..417
TrwB_AAD_bind [PF10412], Evalue: 1.3e-05, Aligned region: 480..518
DUF87 [PF01935], Evalue: 3.6e-05, Aligned region: 482..516
Protein Sequence: 850 a.a.     [Download]
>gi|91791267|ref|YP_552217.1| Type IV secretory pathway VirB4 components-like [Polaromonas sp. JS666]
MLNLKSLIRDYNKEVGSYPELVPWFGQITPGLVICMDGSLLAMFEYDGIDLQSTEGDQHDQASNSMEIAL
RAFDDRNIGWFYVDKRRRTFLGAATGENVVARGVDDAWRESVDDGSLSEIRHYIAIAFRPFRGTMGFFDE
ISSTMMDEHRSLPAAIAKTISSKLRMEKGIEKMQGKIIGATAAFESQISSFMGTLTTLNARRLTDQELLC
SLSDRVNLATPRTKVSCGPLPSYLNTLLVTDTLKRADGGILEFVGATRSQFVQMLSVKGLPQVINNEDVE
ALLSLQGDFSVVQQYRFLDREKAKAYINDCEHHYRSSIKSPMTQAFERLSGNESDSIDMGMLALAEDSSA
ALAELTGDGVNFGYHTMAVMAIGRDRRDLDITLKGIAGLYSNLGYGVVREVVNQVGAFCATIPGGGDSTV
RTSMVSTRNLSDMSLVRSIKSGSSQNEYLTEQLGSPQEALCLFPTTSGVPEYFNFHVGDVGHFAIIGGTG
AGKTTLLNLLIMMWQKYRGARTIVIDKDESCFITIKSMGGSYISIDPEKARAKMNPLRWIKNPNSWAKVA
SWIEGAMSVYGNEAITAQQSTLITQVISQLATREPHRHTLGNFHAQLNGLNQDLAARLAPFVAVAGSANT
QSSGSKYAHLFDGYEDGFAAQLAADSSGIIGIDVNALLKDEKLAPCVIEYLFMAIDEMIDGLSPTMIYLE
EGWYLLQNERFKGVYEDYLRTLRKRRAIIGLATQSVFDIEKVKLSAAFNDNVRTRIYLPSAKAKSAAKVY
IDYLGLTAEHVDVLANAIPKRHYMIEQDGRIRLIDVSLPPEILAHTRSDPRAKLVFKKLLDEGFEGQELS
QAYVKTLLNH
 
Nucleotide Sequence: 2553 bp     [Download]
>gi|91791058|ref|NC_007950.1|:c219127-216575 Polaromonas sp. JS666 plasmid 2, complete sequence
ATGCTGAATTTGAAATCGTTGATTCGCGACTACAACAAAGAGGTTGGGTCCTACCCTGAACTTGTACCCT
GGTTCGGCCAGATCACGCCCGGCTTGGTGATATGCATGGACGGTTCCTTGCTGGCCATGTTTGAGTACGA
CGGCATCGACCTCCAAAGTACCGAGGGCGATCAGCATGATCAGGCCTCTAACTCGATGGAGATCGCACTG
CGGGCGTTCGATGATCGAAATATCGGCTGGTTCTACGTGGACAAGCGCCGGCGCACCTTCCTTGGTGCCG
CGACTGGGGAGAACGTGGTTGCGCGCGGTGTGGACGACGCCTGGCGGGAATCCGTTGACGATGGCTCGCT
TTCGGAGATTCGCCACTATATTGCGATAGCATTTCGGCCGTTTCGCGGCACGATGGGTTTCTTTGACGAG
ATTTCATCGACCATGATGGACGAGCACAGGAGCCTTCCTGCTGCTATTGCCAAAACGATCTCGTCCAAGC
TTAGGATGGAGAAGGGCATCGAGAAGATGCAAGGCAAAATTATCGGTGCGACGGCTGCATTTGAGTCGCA
GATATCTTCATTCATGGGGACGCTTACGACCTTGAACGCGCGGCGCCTTACCGATCAAGAGCTTCTCTGT
AGTCTAAGCGACCGCGTGAATCTTGCGACCCCTCGCACCAAGGTGTCGTGTGGGCCACTTCCGAGCTACC
TAAATACGTTGCTCGTCACCGACACCCTGAAGAGGGCAGACGGCGGCATTTTGGAGTTCGTTGGGGCTAC
GCGCTCGCAGTTCGTTCAGATGTTGAGTGTGAAAGGTCTGCCGCAGGTCATCAACAACGAAGACGTCGAA
GCCCTGCTGTCCCTTCAAGGCGATTTTTCCGTCGTGCAGCAATATCGCTTCCTTGACCGGGAGAAGGCAA
AGGCATACATAAACGATTGCGAACATCACTACCGGTCTTCAATCAAGTCACCGATGACACAGGCCTTCGA
GCGCCTAAGCGGCAACGAGTCCGACTCGATTGACATGGGCATGTTAGCCCTTGCGGAAGATTCATCGGCT
GCCCTGGCGGAATTGACGGGCGATGGGGTCAATTTTGGATACCACACGATGGCTGTCATGGCGATTGGGC
GGGACCGCCGGGACCTGGACATTACCTTAAAGGGAATAGCGGGCCTCTATTCAAATTTGGGCTACGGTGT
GGTACGGGAGGTCGTGAACCAGGTGGGCGCCTTCTGCGCAACGATTCCAGGGGGCGGCGACTCAACCGTG
CGAACCTCTATGGTATCCACTCGGAACTTGTCCGACATGTCCCTGGTCCGGTCGATAAAGTCGGGATCGT
CACAGAACGAGTATTTGACGGAACAGCTGGGCTCTCCTCAGGAAGCCCTCTGCCTCTTCCCTACGACCAG
TGGAGTGCCGGAATATTTCAATTTCCACGTCGGTGACGTCGGCCATTTTGCAATCATTGGTGGGACCGGT
GCCGGCAAGACCACATTGCTGAATTTGCTGATCATGATGTGGCAGAAATACAGAGGTGCTCGAACAATTG
TGATCGACAAGGATGAGAGTTGCTTCATCACAATCAAGTCGATGGGAGGCTCATATATCAGCATTGACCC
TGAGAAGGCCCGTGCAAAGATGAATCCCCTTCGGTGGATAAAGAACCCAAATTCATGGGCGAAGGTAGCG
TCCTGGATCGAGGGTGCGATGTCAGTTTATGGAAACGAGGCCATCACGGCGCAGCAATCAACGCTGATAA
CCCAAGTTATTTCTCAACTTGCTACGCGCGAACCACACCGGCACACGCTCGGCAACTTCCATGCTCAACT
GAACGGACTGAACCAGGATCTCGCCGCGAGGCTCGCACCGTTCGTTGCAGTTGCCGGATCCGCGAATACC
CAAAGCTCAGGGTCGAAGTACGCCCACCTTTTCGATGGCTATGAAGATGGGTTTGCAGCGCAACTCGCCG
CTGACTCAAGCGGAATCATCGGCATTGACGTGAATGCTTTGTTGAAAGATGAAAAGCTTGCGCCGTGTGT
GATCGAGTATCTTTTCATGGCGATTGACGAGATGATCGATGGACTCTCGCCAACAATGATCTACCTGGAG
GAGGGGTGGTATCTGCTTCAAAATGAGCGTTTCAAGGGTGTCTACGAAGACTACTTGAGGACATTACGGA
AGCGGAGGGCAATCATTGGCCTCGCTACGCAGTCGGTTTTTGACATCGAGAAGGTAAAGCTCTCTGCTGC
GTTCAACGACAACGTTCGCACCAGAATTTACCTGCCAAGCGCAAAGGCTAAATCTGCCGCGAAGGTATAT
ATCGATTATCTGGGTCTCACAGCTGAGCACGTCGACGTGCTCGCGAACGCCATACCCAAGCGCCATTACA
TGATCGAGCAGGACGGTCGTATTCGCTTGATCGATGTCTCGTTACCGCCAGAAATCCTTGCACATACCCG
GTCCGATCCGCGGGCGAAACTTGTGTTCAAGAAGCTTCTCGATGAGGGCTTTGAAGGCCAGGAACTGTCC
CAAGCCTATGTCAAAACCCTATTGAACCACTGA
 Primer design