SecReT4
Protein ID: 91791268
T4SS name [ID]Trb [772]
Gene symbol-
Locus tagBpro_5466
StrainPolaromonas sp. JS666
Repliconplasmid 2 [GenBank: NC_007950] [Browse all T4SS(s) in this replicon]
Location [Strand]219121..219420 [-]
Producttype IV secretory pathway, VirB3-like
Component typeTrbD
UniProt IDQ11ZH2
KEGG IDpol:Bpro_5466
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 5.4e-08, Aligned region: 4..72
Protein Sequence: 99 a.a.     [Download]
>gi|91791268|ref|YP_552218.1| type IV secretory pathway, VirB3-like [Polaromonas sp. JS666]
MRASLIHSSLNRRRAVMGVPITIFGVESLLLVLMLGGGMYAFLLILLPIHFSARWMHSRDDGAFEAMFTY
MREQDVYDPWHRPATTTKRPAGYGKDLQC
 
Nucleotide Sequence: 300 bp     [Download]
>gi|91791058|ref|NC_007950.1|:c219420-219121 Polaromonas sp. JS666 plasmid 2, complete sequence
ATGCGTGCATCCCTAATCCACTCAAGCCTCAACCGCCGTCGGGCGGTCATGGGGGTTCCGATCACCATAT
TCGGGGTGGAGTCGCTGCTTCTTGTTCTCATGTTGGGCGGCGGGATGTACGCCTTTTTGCTGATTCTCCT
CCCCATCCATTTCTCCGCCCGGTGGATGCACTCGCGCGACGACGGAGCGTTTGAGGCCATGTTCACCTAC
ATGCGGGAGCAAGACGTCTACGACCCCTGGCATCGGCCGGCAACGACCACCAAGCGCCCTGCCGGCTACG
GGAAAGACCTTCAATGCTGA
 Primer design