SecReT4
Protein ID: 91791269
T4SS name [ID]Trb [772]
Gene symbol-
Locus tagBpro_5467
StrainPolaromonas sp. JS666
Repliconplasmid 2 [GenBank: NC_007950] [Browse all T4SS(s) in this replicon]
Location [Strand]219427..219792 [-]
Producthypothetical protein
Component typeTrbC
UniProt IDQ11ZH1
KEGG IDpol:Bpro_5467
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4.3e-08, Aligned region: 14..102
Protein Sequence: 121 a.a.     [Download]
>gi|91791269|ref|YP_552219.1| hypothetical protein Bpro_5467 [Polaromonas sp. JS666]
MFSSINKPAQSLDQAIRLFIVLLAAFILTSAPEHAYAQSTSFSLPGLDNVLCGIYTYLAKKILFYVALIV
AIVGILAYLLKMDKGVWGTLFVIALLIGIAQGLGSVLSSLGSFDVQCAAIR
 
Nucleotide Sequence: 366 bp     [Download]
>gi|91791058|ref|NC_007950.1|:c219792-219427 Polaromonas sp. JS666 plasmid 2, complete sequence
ATGTTTTCGTCCATTAACAAACCCGCGCAATCCCTCGACCAGGCAATCCGGCTCTTTATCGTGCTGCTGG
CGGCCTTTATCCTGACCTCGGCACCAGAGCATGCCTATGCTCAATCAACCAGTTTCTCTCTTCCGGGCCT
GGACAATGTGCTTTGTGGCATCTACACCTATCTCGCCAAGAAGATCCTCTTCTATGTGGCGCTGATCGTG
GCCATCGTCGGTATCCTGGCCTATCTGCTGAAGATGGACAAGGGCGTGTGGGGCACGCTCTTCGTCATCG
CGCTGTTGATCGGAATTGCCCAGGGTCTGGGCTCGGTCCTGAGCTCACTTGGTTCGTTCGACGTGCAGTG
CGCAGCTATCCGTTAA
 Primer design