SecReT4
Protein ID: 91791270
T4SS name [ID]Trb [772]
Gene symbol-
Locus tagBpro_5468
StrainPolaromonas sp. JS666
Repliconplasmid 2 [GenBank: NC_007950] [Browse all T4SS(s) in this replicon]
Location [Strand]219897..220871 [-]
Producttype II secretion system protein E
Component typeTrbB
UniProt IDQ11ZH0
KEGG IDpol:Bpro_5468
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 5.1e-61, Aligned region: 12..260
AAA_25 [PF13481], Evalue: 4.2e-05, Aligned region: 141..247
AAA_16 [PF13191], Evalue: 5.4e-05, Aligned region: 118..167
Protein Sequence: 324 a.a.     [Download]
>gi|91791270|ref|YP_552220.1| type II secretion system protein E [Polaromonas sp. JS666]
MQSQSLALDYLAPVMELLRAADVTEVMINGADKVFVKRYGSKKHRVDIKISDQEISSAITNLASISFREV
GVGNATGHKIISAQLPGYRIEAWLSPVAVMGSCLTIRKLGSSVFTLDQLVGRGLLTEAVAAYLTNAVLEE
KNIFLAGGTGSGKTTLANSLLAVIPDDQRMIVIETIHELNLRQENVVYFEADSEQGVSVRRLIKSAMRGF
PDRIIVGEVRGEEAYDLIYAAKSGHPGTVATLHADDAQSILEKLEDMCIEGQPSLPLISHRKRIASAAHV
LGFMSEVTTAKGNELRLCELREVIGLDADGNYATKLIFGYEPDA
 
Nucleotide Sequence: 975 bp     [Download]
>gi|91791058|ref|NC_007950.1|:c220871-219897 Polaromonas sp. JS666 plasmid 2, complete sequence
ATGCAATCGCAATCCTTGGCACTCGACTATCTGGCTCCTGTCATGGAGCTCCTGCGCGCGGCTGATGTCA
CAGAGGTGATGATCAACGGCGCGGACAAAGTCTTCGTCAAGAGATATGGGTCTAAAAAGCACCGGGTCGA
CATCAAGATCAGTGACCAGGAAATCTCGTCTGCGATCACCAATCTCGCCTCAATCAGCTTTCGCGAGGTA
GGCGTTGGCAACGCCACCGGGCACAAGATCATAAGTGCGCAGCTTCCGGGCTACCGGATTGAGGCATGGC
TTTCGCCGGTCGCAGTGATGGGATCGTGCCTCACCATTCGGAAGCTGGGCTCTAGCGTGTTCACCCTCGA
TCAATTGGTGGGCCGGGGCCTACTTACCGAGGCTGTCGCCGCATACCTGACGAATGCGGTGCTTGAGGAG
AAGAATATCTTCCTCGCGGGCGGGACCGGCTCAGGGAAGACTACCCTCGCGAATTCCTTGCTTGCGGTTA
TTCCCGACGACCAGCGAATGATCGTGATCGAGACGATCCACGAGCTCAATCTCCGGCAAGAAAACGTCGT
CTACTTCGAGGCTGATAGCGAGCAGGGAGTCTCGGTCAGACGCCTGATCAAATCCGCCATGCGCGGCTTT
CCAGACCGGATCATTGTTGGCGAGGTTCGAGGCGAAGAAGCATACGACCTCATTTATGCCGCCAAGTCGG
GGCATCCTGGCACTGTGGCGACGCTGCATGCAGACGACGCCCAAAGCATCCTGGAGAAGCTGGAAGACAT
GTGCATTGAGGGCCAGCCCAGCCTGCCGCTCATATCTCACCGCAAGCGCATTGCCTCGGCCGCCCACGTC
TTGGGGTTTATGTCTGAGGTGACTACTGCCAAGGGCAATGAACTTCGATTGTGCGAGCTGCGCGAAGTGA
TTGGCCTCGATGCCGACGGCAACTACGCCACCAAACTCATTTTTGGATACGAGCCCGATGCCTAG
 Primer design