SecReT4
Protein ID: 91791273
T4SS name [ID]Trb [772]
Gene symbol-
Locus tagBpro_5471
StrainPolaromonas sp. JS666
Repliconplasmid 2 [GenBank: NC_007950] [Browse all T4SS(s) in this replicon]
Location [Strand]222200..224107 [-]
Producthypothetical protein
Component typeTraG
UniProt IDQ11ZG7
KEGG IDpol:Bpro_5471
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 1.3e-18, Aligned region: 481..610
TrwB_AAD_bind [PF10412], Evalue: 4.9e-16, Aligned region: 165..203
TrwB_AAD_bind [PF10412], Evalue: 4.9e-16, Aligned region: 476..617
AAA_10 [PF12846], Evalue: 9.2e-13, Aligned region: 165..561
T4SS-DNA_transf [PF02534], Evalue: 2.6e-08, Aligned region: 467..619
Protein Sequence: 635 a.a.     [Download]
>gi|91791273|ref|YP_552223.1| hypothetical protein Bpro_5471 [Polaromonas sp. JS666]
MRELKADSLFRPVFEGRAALAWSLALLWIVGLALFSNLSGTAMAMMLFFAMFMMVLRYYQAAQVWDYKVR
LSGAAIDKVSTSQLDGVQKQLQDSVWLGWGWEWQPSHTQQAYDILKRDTEEIYPPNWFLRLKGVKFDPRG
MKGRQWVHGLGTEKDVIVPFTGFAGHTAIAATTGAIKTSLYKLLVYQFVRAGDTVIIIDPKGDKDLKAIG
QDAATACGDPSRFISFHPAFPSQGVRFDGLKNWERESQVASRITQIISAGEEGNNFIDFCWQVITSIVAC
MKIIGRRPTIASILDHIRALDNSEKLCEDVLVQWLTPRVDNFSSQINEKIQSITSAQNAKGGRAKSTFAE
KAEPRLLALIAFFKEYQGPKPAEIDSLIGNLESNREWFGKMIVALTPTLTKLSTGDLRGMLSPDYDDPTD
LRPIYDMGKVIQEGKIFYMGTDALSDPAVASAIAAFAISDLAAEAGSLYNYTEPGQKRQKRVHLLIDEGS
NAICAPLIEICNKGRGAGIHVYLAFQAFSDIVTKMGGDVNAAKRFMANMNNLIVGATQDTDTLDLISDKF
GEVDVVSANRSQGSGQKTEDVGLEYSATKSISFSEKNRVMIPRSVLMSMPDLQYVAVVNRAKIFKGRIPI
LEFQN
 
Nucleotide Sequence: 1908 bp     [Download]
>gi|91791058|ref|NC_007950.1|:c224107-222200 Polaromonas sp. JS666 plasmid 2, complete sequence
ATGCGTGAACTGAAAGCCGACTCACTCTTTCGCCCCGTTTTCGAAGGTCGGGCAGCCTTGGCCTGGTCCC
TCGCGCTGCTCTGGATCGTGGGACTCGCGCTGTTTTCCAACCTGTCAGGGACGGCTATGGCGATGATGCT
GTTTTTCGCCATGTTCATGATGGTCCTGCGCTACTACCAGGCTGCGCAGGTATGGGACTACAAAGTCCGC
CTGTCCGGGGCCGCGATCGACAAAGTCAGCACTTCGCAGCTGGACGGCGTGCAGAAGCAGCTGCAGGACA
GCGTATGGCTCGGCTGGGGATGGGAGTGGCAGCCTAGCCATACACAGCAGGCCTACGACATCCTGAAACG
GGACACCGAGGAGATCTATCCCCCCAACTGGTTCCTCAGGCTGAAAGGCGTTAAGTTCGATCCGCGCGGC
ATGAAGGGCCGCCAGTGGGTGCACGGACTCGGCACCGAAAAAGATGTAATTGTTCCGTTCACCGGCTTTG
CTGGCCACACGGCCATTGCGGCGACGACAGGTGCGATCAAGACCAGCTTGTACAAACTGCTCGTCTACCA
ATTCGTGCGCGCGGGCGACACGGTCATCATCATCGACCCGAAAGGGGACAAGGATTTGAAAGCGATTGGA
CAGGACGCGGCGACCGCCTGCGGGGATCCCTCGCGCTTCATCAGTTTCCATCCGGCATTTCCAAGCCAAG
GTGTGCGTTTCGACGGCCTGAAGAACTGGGAGCGTGAATCCCAGGTAGCTTCTCGAATCACGCAGATCAT
CAGCGCCGGTGAAGAAGGAAACAACTTCATCGACTTTTGCTGGCAGGTTATTACGAGCATTGTGGCCTGC
ATGAAGATCATTGGGCGCCGGCCGACGATTGCGTCAATCCTCGACCATATCCGCGCCCTGGATAACTCCG
AGAAGCTGTGTGAAGACGTCCTGGTCCAGTGGCTCACGCCTCGCGTCGACAACTTCTCGTCGCAAATCAA
CGAGAAGATCCAAAGCATCACGTCCGCGCAGAACGCGAAGGGCGGCAGAGCCAAGTCCACCTTCGCAGAG
AAGGCTGAACCGCGACTGTTGGCCTTGATCGCCTTCTTCAAGGAATACCAGGGTCCGAAACCAGCGGAGA
TCGATAGCCTCATTGGCAATCTGGAGTCAAACCGCGAGTGGTTCGGGAAGATGATCGTTGCCCTGACGCC
AACGCTGACAAAGCTGTCCACCGGAGACCTTCGCGGGATGCTCTCGCCGGACTATGACGATCCGACGGAT
CTCCGGCCTATCTATGACATGGGGAAGGTCATTCAGGAGGGGAAGATCTTCTACATGGGCACGGACGCCC
TATCGGATCCGGCCGTGGCCTCCGCAATCGCCGCATTTGCGATTTCGGATCTTGCCGCCGAAGCGGGCTC
TCTCTACAACTACACCGAGCCCGGGCAGAAGCGCCAAAAGCGCGTTCACCTTCTAATCGACGAAGGGTCG
AATGCGATCTGCGCGCCGCTCATTGAGATCTGCAACAAGGGGCGCGGCGCTGGCATCCACGTCTACCTTG
CGTTCCAGGCGTTCAGCGACATCGTCACCAAAATGGGCGGGGATGTGAACGCCGCAAAGCGATTCATGGC
CAACATGAACAACCTGATTGTGGGCGCCACACAGGACACCGACACCCTGGACCTGATCTCGGACAAGTTC
GGCGAGGTCGACGTCGTTTCGGCCAATCGCTCGCAGGGTTCCGGTCAGAAAACGGAGGACGTTGGGTTGG
AGTACTCGGCGACGAAGAGCATCAGCTTTAGCGAAAAGAATCGCGTGATGATCCCACGCAGCGTGCTGAT
GTCTATGCCTGACCTCCAGTATGTTGCAGTCGTAAACAGGGCCAAGATCTTCAAAGGCCGCATCCCAATT
CTCGAATTTCAAAATTAA
 Primer design