SecReT4
Protein ID: 92109565
T4SS name [ID]VirB [214]
Gene symbol-
Locus tagNham_4436
StrainNitrobacter hamburgensis X14
Repliconplasmid 2 [GenBank: NC_007960] [Browse all T4SS(s) in this replicon]
Location [Strand]82387..84531 [-]
ProductTRAG protein
Component typeVirD4
UniProt IDQ1QFH7
KEGG IDnha:Nham_4436
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 9.9e-77, Aligned region: 148..553
TraG-D_C [PF12696], Evalue: 5.8e-24, Aligned region: 402..522
TrwB_AAD_bind [PF10412], Evalue: 4.3e-21, Aligned region: 148..485
Protein Sequence: 714 a.a.     [Download]
>gi|92109565|ref|YP_571852.1| TRAG protein [Nitrobacter hamburgensis X14]
MARVVAYRIGIAVLLLLAFWLLWSMAYEVVVALRWAPSRFPSEGASRWALFRMQNTDRSVDFFLIAWRHF
YDRLLFPSMRLEALIRAGYAVAAVGALAIAGVMFAVINRRQMPYGEARFGTLMEAARQGLTAKQGIVLGT
LGGATIRSDEPAHILVVGPSRSGKGTGFVLPNGYLWQGSAVFFDPKRENFDALANHRAAMGNKVFMFSPG
SNDTHRYNPLDFVRRDARMATDCLVVASFVIPEKADDTWAGAGRLLLSALIGYVLSSPLIAGAQHMRTVA
RMTTTGKDISSVLRAIVKTECQHLPTWVVDSFNQYIALEPETRNSAVFNVNMATSLWNNGLISAATETSD
FDIRELRRQPMTIFIGCTIAELSIFRPLIRILFQQIHDLMMVKIPGADEPHQVLLMLDEFYHVGRMDSLI
SKITISAGYGFRMAIVMQDIAQLDELYGKNTRITTVSGSQIKLFIQINDLETSDFVSEMLGETTQVYKTP
IQRPGQGIFAPRVWAPHYTPRPLRSPLELREMSARLSILMVKNSRSFELTKIRHYLDKPYRAFYEKAKGS
PPVLPALRDWQDESLGGAINPMPDQTKKLADAGPAPMEMNSPTPRKTKSRRPPKSASNKATATERPQAPA
APLTLVARRTAKPESKSLSLGIAPPAPPGESCDVRNILKSAEARQDEEFSAMMRVLDTSSGSKTREAADT
LALLHRSFGDDTKP
 
Nucleotide Sequence: 2145 bp     [Download]
>gi|92109490|ref|NC_007960.1|:c84531-82387 Nitrobacter hamburgensis X14 plasmid 2, complete sequence
ATGGCGCGCGTCGTCGCCTATAGGATCGGCATCGCGGTCCTGCTGCTGCTCGCCTTCTGGCTGTTGTGGA
GCATGGCCTACGAGGTTGTCGTGGCTCTTCGCTGGGCGCCGAGCCGGTTTCCCAGCGAAGGCGCATCCCG
CTGGGCTTTGTTCCGGATGCAGAACACCGATCGCTCCGTCGACTTCTTTCTGATCGCTTGGCGTCATTTC
TATGACCGGCTGCTGTTTCCAAGCATGCGCCTCGAAGCGCTGATCCGCGCCGGCTATGCCGTGGCCGCGG
TTGGCGCGCTCGCCATCGCCGGGGTCATGTTTGCGGTCATCAATCGCCGGCAGATGCCCTACGGCGAAGC
CCGCTTCGGCACGCTGATGGAGGCAGCCAGGCAAGGCCTCACGGCGAAGCAGGGCATCGTCCTGGGGACA
TTGGGTGGGGCGACCATCCGCTCGGACGAACCGGCACACATTCTCGTCGTCGGCCCCTCACGGTCGGGCA
AAGGCACTGGCTTCGTCCTTCCGAATGGCTACCTCTGGCAGGGCTCGGCCGTGTTCTTCGATCCCAAGCG
CGAGAACTTCGACGCGCTGGCCAATCATCGTGCGGCCATGGGCAACAAGGTGTTCATGTTCTCGCCCGGC
TCGAACGACACCCATCGCTACAATCCCCTCGACTTTGTCCGGCGGGACGCGCGGATGGCGACGGACTGCC
TGGTGGTGGCGTCGTTCGTGATCCCTGAGAAGGCCGACGATACCTGGGCGGGCGCCGGCCGTCTCCTGCT
CTCGGCGCTGATTGGCTACGTCCTGTCGTCGCCCTTGATTGCCGGCGCACAGCATATGCGCACCGTCGCG
CGAATGACCACAACGGGCAAGGACATTTCATCGGTCTTGCGCGCCATCGTGAAAACCGAATGTCAGCATC
TCCCGACCTGGGTCGTCGACAGCTTTAACCAGTATATCGCGCTCGAGCCGGAGACCCGCAACAGTGCGGT
GTTCAACGTCAATATGGCGACGTCGCTGTGGAACAACGGGCTGATTTCGGCGGCGACTGAGACCTCCGAC
TTCGACATCCGCGAACTGCGCCGTCAGCCGATGACCATCTTCATCGGCTGCACCATCGCGGAGCTCTCGA
TCTTCCGGCCGCTGATCCGGATTCTGTTCCAGCAGATCCACGACCTGATGATGGTGAAGATTCCAGGCGC
GGACGAACCACACCAGGTGCTGCTGATGCTCGACGAATTCTACCATGTCGGGCGGATGGATTCTCTGATC
TCCAAGATCACGATCAGCGCCGGCTACGGCTTTCGCATGGCGATTGTCATGCAGGATATCGCGCAGCTCG
ATGAACTCTACGGCAAGAATACACGCATCACCACGGTATCCGGCTCGCAGATCAAACTCTTCATCCAGAT
CAACGACCTCGAAACCTCAGACTTCGTGTCCGAGATGCTCGGGGAGACTACGCAAGTCTATAAGACGCCG
ATCCAGCGGCCAGGGCAGGGGATCTTCGCACCGCGCGTCTGGGCGCCGCATTATACGCCCCGGCCGCTTC
GCAGTCCGCTCGAGCTTCGGGAAATGTCAGCGCGGCTCTCGATCCTGATGGTGAAGAACTCACGATCGTT
TGAATTGACGAAAATCCGGCATTATCTCGATAAGCCATACAGGGCCTTCTACGAGAAGGCCAAGGGATCG
CCGCCAGTCTTGCCGGCGTTGCGAGACTGGCAGGACGAGTCTCTCGGCGGCGCGATCAATCCGATGCCCG
ACCAAACGAAAAAACTGGCGGATGCCGGCCCAGCCCCAATGGAAATGAACTCACCAACTCCACGAAAGAC
AAAGTCGCGGCGCCCTCCAAAATCGGCATCCAACAAGGCGACGGCAACAGAACGGCCTCAAGCCCCGGCC
GCGCCGCTCACGCTGGTCGCGCGACGAACGGCAAAGCCTGAATCGAAATCTCTGTCACTTGGTATCGCGC
CACCCGCTCCGCCGGGAGAAAGCTGTGACGTTCGCAATATCCTGAAGTCTGCCGAGGCTCGCCAGGACGA
AGAGTTCTCCGCCATGATGCGTGTCTTGGATACCTCATCTGGATCCAAAACGCGTGAGGCAGCCGACACT
CTCGCATTATTGCACCGCTCCTTTGGCGATGACACGAAACCGTAA
 Primer design