SecReT4
Protein ID: 92109566
T4SS name [ID]VirB [214]
Gene symbol-
Locus tagNham_4437
StrainNitrobacter hamburgensis X14
Repliconplasmid 2 [GenBank: NC_007960] [Browse all T4SS(s) in this replicon]
Location [Strand]84509..85558 [-]
Producttype II secretion system protein E
Component typeVirB11
UniProt IDQ1QFH6
KEGG IDnha:Nham_4437
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.4e-87, Aligned region: 13..314
Protein Sequence: 349 a.a.     [Download]
>gi|92109566|ref|YP_571853.1| type II secretion system protein E [Nitrobacter hamburgensis X14]
MARSLTVFIDRALEPIRPWLKDDQVVEICANGPGEVWVERFGQSAMERHDVPHLTEHALRHLAERVAGHS
GQSVNEEHPLLSAALPTGERFQGVMPPATTAGGAFAIRKQVIKEMRLDDYRKLGSFEKVSTAGEGALSET
DRRLCEHLDAGRIEDFIRLAVANRYSILLSGGTSSGKTTFLNAILKEVPVDERIITIEDTREVNPIQKNY
LPLVASKGDQGEARVTVETLLQASMRLRPDRIFLGEIRGAEAYSFLRAINTGHPGSITTVHADSPAGAFE
QLALMVMQAGLGLRRDEIVGYIKSVLPIVIQQTKVGGWRGTSAVHFSRMAEWREQRTGGKGRHGARRRL
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|92109490|ref|NC_007960.1|:c85558-84509 Nitrobacter hamburgensis X14 plasmid 2, complete sequence
TTGGCGCGAAGCCTGACGGTCTTCATTGATCGGGCCCTTGAACCGATCCGGCCGTGGCTCAAGGATGATC
AGGTCGTCGAGATCTGCGCCAATGGGCCGGGTGAGGTCTGGGTCGAGCGGTTTGGCCAGTCGGCGATGGA
ACGCCATGACGTCCCACATCTGACGGAGCACGCGCTGCGCCACCTCGCGGAGCGCGTCGCCGGCCATTCC
GGTCAGAGCGTCAATGAGGAGCATCCGCTGCTGTCGGCCGCCTTGCCGACCGGCGAGCGCTTCCAGGGCG
TGATGCCGCCGGCGACCACCGCCGGGGGCGCGTTCGCGATCCGCAAGCAGGTGATCAAGGAGATGCGGCT
CGACGATTACCGCAAGCTCGGCTCCTTCGAAAAAGTGTCGACAGCGGGCGAGGGCGCCCTCTCCGAAACC
GACCGTCGGCTGTGCGAACACCTCGATGCTGGCCGGATCGAGGACTTCATCCGCTTGGCGGTCGCCAACC
GCTATTCGATCCTTCTGTCGGGCGGGACGAGTTCCGGCAAGACAACATTTTTGAACGCAATTCTTAAGGA
AGTGCCGGTCGACGAACGCATCATCACCATCGAGGATACGCGGGAGGTCAATCCGATTCAGAAAAACTAC
CTGCCGCTGGTCGCCTCCAAAGGAGACCAGGGCGAGGCGCGTGTCACGGTCGAAACCTTGCTGCAGGCCT
CGATGCGGCTTCGGCCCGACCGCATCTTTCTCGGCGAGATCCGCGGCGCCGAGGCCTATTCATTTCTGCG
CGCCATCAACACCGGCCATCCCGGCAGCATCACCACGGTGCATGCCGACAGCCCAGCGGGCGCGTTCGAG
CAACTCGCGCTGATGGTGATGCAGGCGGGATTAGGCCTGCGGCGCGACGAGATCGTCGGCTACATCAAGT
CGGTGCTGCCAATCGTGATCCAGCAGACCAAGGTCGGCGGCTGGCGCGGCACGTCGGCGGTGCATTTCTC
GCGCATGGCGGAATGGCGGGAGCAGCGGACCGGAGGGAAAGGCCGTCATGGCGCGCGTCGTCGCCTATAG
 Primer design