SecReT4
Protein ID: 92109569
T4SS name [ID]VirB [214]
Gene symbol-
Locus tagNham_4440
StrainNitrobacter hamburgensis X14
Repliconplasmid 2 [GenBank: NC_007960] [Browse all T4SS(s) in this replicon]
Location [Strand]87674..88390 [-]
ProductVirB8
Component typeVirB8
UniProt IDQ1QFH3
KEGG IDnha:Nham_4440
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 7.4e-63, Aligned region: 21..226
Protein Sequence: 238 a.a.     [Download]
>gi|92109569|ref|YP_571856.1| VirB8 [Nitrobacter hamburgensis X14]
MTETTASESARVDSRYYADGATWERDIARRNRNSRALAWIVAAVMTIVAVGALGTLALLVPLKTYEPYMV
VVDKTTGFVEVKRPMAEGPLTQDEAVTTFNVVRYIKARETYDPKALKDNFDLAQLLASGDASRELTEIYS
PANPSNPVKVFGSNTVIAVNIKSVTFPNNRTALARFSTEEKSSTNIITRNWVSLVRFRYTSAPMRNEWRF
DNPLGFQVLEYRRDQETAPSPGTVGAQQ
 
Nucleotide Sequence: 717 bp     [Download]
>gi|92109490|ref|NC_007960.1|:c88390-87674 Nitrobacter hamburgensis X14 plasmid 2, complete sequence
ATGACGGAGACAACAGCCTCAGAGTCCGCGCGGGTCGATTCGCGCTATTACGCCGACGGCGCGACATGGG
AGCGGGATATCGCGCGCCGAAATCGCAATTCGCGGGCGCTTGCCTGGATCGTCGCCGCGGTCATGACAAT
CGTGGCCGTCGGCGCACTCGGCACCTTGGCTTTGCTGGTCCCGCTCAAGACCTACGAGCCGTACATGGTC
GTGGTCGACAAGACCACCGGCTTCGTCGAGGTGAAGCGGCCGATGGCGGAGGGTCCGCTGACCCAGGACG
AGGCCGTCACGACATTCAATGTCGTCCGCTACATCAAGGCGCGCGAGACCTATGACCCGAAGGCGCTGAA
AGATAATTTCGATCTGGCGCAATTATTGGCCAGTGGCGATGCGAGCCGTGAACTGACCGAAATCTATTCG
CCCGCCAATCCCAGCAACCCTGTGAAAGTCTTCGGTTCGAACACCGTGATCGCCGTCAACATCAAGTCCG
TGACCTTTCCGAACAACCGCACGGCGCTCGCGCGTTTCTCCACCGAGGAGAAGTCCTCGACCAACATCAT
CACCCGCAACTGGGTGTCGCTGGTGCGCTTCCGCTATACCTCCGCGCCGATGCGTAACGAATGGCGGTTC
GACAATCCCCTCGGTTTCCAGGTGCTCGAGTATCGCCGCGATCAGGAGACCGCGCCCTCACCGGGAACGG
TAGGTGCGCAGCAATGA
 Primer design