SecReT4
Protein ID: 92109665
T4SS name [ID]Trb [246]
Gene symbol-
Locus tagNham_4541
StrainNitrobacter hamburgensis X14
Repliconplasmid 3 [GenBank: NC_007961] [Browse all T4SS(s) in this replicon]
Location [Strand]3442..3975 [+]
Productconjugal transfer pilin processing protease TraF
Component typeTraF
UniProt IDQ1QF78
KEGG IDnha:Nham_4541
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 4.1e-44, Aligned region: 30..174
Protein Sequence: 177 a.a.     [Download]
>gi|92109665|ref|YP_571951.1| conjugal transfer pilin processing protease TraF [Nitrobacter hamburgensis X14]
MRRQRSLLVVIATGAGAVLCLALTGWCADLRINMTPSYPRGLWRIEALDRPADVGDRIFICPPDTAVFER
AFKRGYIRRGLCAGGLSPLIKTVAAIGGQQIDVAARVSIDGRVLGHSNVRRMDAAGRPLLPFAGGVIPAG
ALFLHSDFAGSYDSRYFGPIPASGILGLARPVLTFDR
 
Nucleotide Sequence: 534 bp     [Download]
>gi|92109663|ref|NC_007961.1|:3442-3975 Nitrobacter hamburgensis X14 plasmid 3, complete sequence
ATGAGACGCCAGCGCTCTCTTCTGGTCGTAATTGCGACCGGCGCCGGCGCCGTGCTTTGCCTTGCCCTCA
CTGGCTGGTGCGCCGACCTGCGCATCAACATGACGCCGAGCTATCCGCGCGGCCTGTGGCGGATAGAGGC
GCTCGATCGGCCGGCCGACGTCGGCGACCGCATCTTCATCTGTCCGCCCGACACGGCTGTGTTCGAACGC
GCGTTCAAGCGCGGATATATCAGACGCGGGCTGTGCGCCGGCGGCTTGAGCCCGCTCATCAAGACCGTTG
CCGCAATCGGCGGACAGCAGATCGATGTCGCGGCGCGCGTGTCGATCGACGGCCGCGTGCTCGGTCATTC
CAACGTCAGGCGCATGGATGCCGCCGGCAGGCCACTCTTGCCGTTCGCGGGCGGCGTCATTCCCGCCGGC
GCACTTTTTCTCCACTCCGATTTTGCAGGCTCCTATGACTCCCGCTACTTCGGCCCGATCCCGGCATCGG
GCATCCTTGGCCTCGCCCGGCCCGTTCTCACCTTCGACAGGTAG
 Primer design