SecReT4
Protein ID: 92109680
T4SS name [ID]Trb [246]
Gene symbol-
Locus tagNham_4559
StrainNitrobacter hamburgensis X14
Repliconplasmid 3 [GenBank: NC_007961] [Browse all T4SS(s) in this replicon]
Location [Strand]15988..17289 [-]
Productconjugal transfer protein TrbI
Component typeTrbI
UniProt IDQ1QF63
KEGG IDnha:Nham_4559
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 9.3e-63, Aligned region: 243..427
Protein Sequence: 433 a.a.     [Download]
>gi|92109680|ref|YP_571966.1| conjugal transfer protein TrbI [Nitrobacter hamburgensis X14]
MAQSLKLGGTPEGEEARGIRRLNQLPIIVAIVLVIVFFAVIFYGLTSRGLYVHRAAGIDTASSSPATTFA
DQLKKGISNGIIGDQSEAQAFQPAPQSEAPKPPSNPLAGRQQAEASASTLEREAVWRARLEREAHEQYLR
ERQRERMARVQANDAAYDSPLALNLGKLQTSTAPTSGGAPSKATSTPGFAGGANDLYAAALRAGFGTQNI
DPNGQGAKEDFFNADLKKLGYLPNKVVAPTSAYELKRGSVIPATLITGINSDLPGRITAQVSQNVYDSAT
GHDLLIPQGTKLLGRYDSKISFGQSRVLVIWTDIIFPNGATLQIGGMAGTDSEGYGGFNDQVDNHYFKVF
GSAILIAAIGAGIDMSVPASSPYGYRQTPTDAARNSFAETFGRVAEQTISKNLNVQPTLEIRPGYVFNVL
VDQDMVFLGAYRG
 
Nucleotide Sequence: 1302 bp     [Download]
>gi|92109663|ref|NC_007961.1|:c17289-15988 Nitrobacter hamburgensis X14 plasmid 3, complete sequence
ATGGCGCAATCCCTGAAGCTCGGCGGCACACCGGAGGGCGAGGAGGCGAGAGGCATCCGACGCCTCAACC
AGCTGCCGATCATCGTCGCCATCGTGCTGGTGATCGTGTTCTTCGCCGTGATCTTCTACGGCCTCACCTC
GCGCGGGCTTTATGTCCATCGAGCGGCCGGGATCGACACGGCTTCGTCCAGTCCAGCCACCACCTTCGCC
GATCAGCTGAAGAAGGGAATCTCCAACGGCATTATCGGCGACCAGTCGGAGGCGCAAGCCTTTCAGCCGG
CGCCGCAGTCCGAAGCGCCGAAACCCCCGAGCAATCCGCTCGCCGGCCGACAACAAGCCGAAGCGTCGGC
ATCAACGCTCGAGCGGGAGGCAGTCTGGCGGGCGCGCCTCGAGCGGGAGGCGCATGAGCAATATCTGCGC
GAACGGCAGCGCGAGCGCATGGCGCGCGTCCAGGCCAACGATGCCGCCTATGATTCTCCACTTGCCCTCA
ATCTCGGCAAGCTTCAGACGTCGACCGCGCCGACGAGCGGCGGAGCACCGTCGAAGGCAACGTCGACACC
GGGCTTTGCCGGCGGCGCGAACGATCTCTACGCGGCGGCGCTGCGCGCGGGTTTCGGCACGCAGAACATC
GATCCGAACGGGCAGGGGGCGAAGGAGGACTTCTTCAACGCCGACCTGAAGAAGCTCGGCTACCTTCCCA
ACAAGGTGGTCGCGCCGACCTCGGCCTATGAACTCAAACGCGGCTCGGTCATTCCGGCGACGTTGATCAC
CGGCATCAACTCCGATCTTCCCGGTCGCATCACCGCCCAGGTCAGCCAGAACGTCTACGACAGCGCCACG
GGGCATGACCTGTTGATCCCGCAAGGCACGAAATTGTTGGGGCGCTACGATTCCAAGATATCGTTCGGCC
AAAGCCGTGTGCTGGTCATCTGGACGGACATCATCTTCCCGAACGGCGCGACGTTGCAGATCGGCGGCAT
GGCGGGCACGGATTCTGAAGGCTATGGCGGTTTCAACGATCAGGTCGACAACCACTATTTCAAGGTGTTC
GGCTCAGCGATCCTGATCGCTGCGATCGGCGCGGGCATCGATATGTCGGTGCCGGCGAGCTCTCCCTATG
GCTATCGGCAAACGCCAACGGACGCGGCGCGAAACAGCTTTGCCGAGACCTTCGGCCGCGTCGCCGAACA
GACCATCAGCAAGAATCTCAACGTCCAGCCGACGCTGGAGATTCGGCCGGGCTACGTATTCAACGTGCTC
GTCGACCAGGACATGGTGTTTCTAGGCGCTTACCGTGGATGA
 Primer design