SecReT4
Protein ID: 92109681
T4SS name [ID]Trb [246]
Gene symbol-
Locus tagNham_4560
StrainNitrobacter hamburgensis X14
Repliconplasmid 3 [GenBank: NC_007961] [Browse all T4SS(s) in this replicon]
Location [Strand]17300..17752 [-]
Productconjugal transfer protein TrbH
Component typeTrbH
UniProt IDQ1QF62
KEGG IDnha:Nham_4560
PDB IDNA
Domain hit(s) vs Pfam TrbH [PF07283], Evalue: 1.9e-29, Aligned region: 42..147
Protein Sequence: 150 a.a.     [Download]
>gi|92109681|ref|YP_571967.1| conjugal transfer protein TrbH [Nitrobacter hamburgensis X14]
MRVDSLTRRAILLCIVALSLAGCASFGTGGLVASSAPPDLSGPAASAIAGDLVTKFAEQVGPGSGTIILK
RDGSPFGQALETSLKSWGYAVATDQKTGGEKTIPLAYVIASYNGQILARLSTAHVELGRTYAATTAGASP
ASPLSVMRRG
 
Nucleotide Sequence: 453 bp     [Download]
>gi|92109663|ref|NC_007961.1|:c17752-17300 Nitrobacter hamburgensis X14 plasmid 3, complete sequence
ATGCGCGTGGACTCTTTGACCCGCCGAGCCATCCTTCTTTGCATCGTCGCCCTGTCGCTCGCGGGCTGCG
CGTCATTCGGAACCGGCGGCCTGGTGGCAAGCTCGGCACCGCCCGATCTGTCTGGCCCCGCCGCCTCCGC
GATCGCCGGCGATCTGGTTACGAAGTTCGCGGAGCAGGTCGGACCCGGATCGGGGACGATCATCCTGAAG
CGCGACGGCTCGCCGTTCGGCCAGGCGCTCGAGACGTCGCTGAAGAGTTGGGGTTACGCGGTCGCGACCG
ATCAGAAGACCGGCGGCGAAAAGACTATTCCGCTCGCCTATGTCATCGCGTCCTACAACGGCCAAATCCT
GGCGCGGCTATCGACCGCACACGTCGAGCTCGGACGCACCTATGCCGCAACAACCGCCGGCGCGTCGCCG
GCCAGTCCGCTCTCCGTCATGCGGCGTGGATAG
 Primer design