SecReT4
Protein ID: 92109682
T4SS name [ID]Trb [246]
Gene symbol-
Locus tagNham_4561
StrainNitrobacter hamburgensis X14
Repliconplasmid 3 [GenBank: NC_007961] [Browse all T4SS(s) in this replicon]
Location [Strand]17755..18594 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDQ1QF61
KEGG IDnha:Nham_4561
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.1e-57, Aligned region: 64..277
Protein Sequence: 279 a.a.     [Download]
>gi|92109682|ref|YP_571968.1| conjugal transfer protein TrbG [Nitrobacter hamburgensis X14]
MHPYTIRLKTGLFIAAAAFGLLLADVSAHAQVMNAKERKGTHISSQWRGSTGLVTRGADGKVIFLFGEVQ
PSVVCSPLEVCDIELQAGEVVRDVLVGDTVRWKVEPATSGAVGGQAIHLIVKPSEPGLVTSMVVTTSRRT
YHIQLKSNAIQYMARVGFEYPEDVSSKLANINARLGTETIPGAGVPAEQLNFAYSVSGSASWRPTRVYSD
GLKTYIQFPSSLAGQDAPVLFVESGGKDRIVNYRLKGDMMVVDYQIDTAILVSGVSFWHQEKVTIRRGG
 
Nucleotide Sequence: 840 bp     [Download]
>gi|92109663|ref|NC_007961.1|:c18594-17755 Nitrobacter hamburgensis X14 plasmid 3, complete sequence
ATGCACCCATACACCATCAGACTCAAGACAGGGCTTTTCATCGCTGCCGCTGCCTTCGGCTTGCTGCTCG
CCGATGTCAGCGCCCACGCGCAGGTGATGAATGCCAAGGAGCGGAAAGGCACCCACATCTCGAGCCAGTG
GCGCGGATCGACCGGGCTCGTGACGCGCGGAGCCGACGGCAAGGTGATTTTCCTCTTCGGAGAGGTGCAG
CCTTCCGTGGTCTGCTCGCCACTTGAGGTCTGCGATATCGAACTCCAGGCGGGTGAGGTCGTGCGCGATG
TGCTGGTCGGCGACACGGTGCGCTGGAAGGTCGAGCCGGCGACGTCGGGCGCGGTCGGCGGCCAAGCTAT
CCACCTGATCGTCAAGCCGTCGGAGCCCGGGCTCGTCACCTCGATGGTGGTGACCACCTCGCGACGGACC
TACCACATCCAGCTCAAGTCGAACGCAATACAATACATGGCGCGCGTCGGCTTCGAATATCCCGAGGACG
TCAGCAGCAAGTTGGCCAACATTAACGCGCGTCTTGGCACTGAGACGATCCCCGGCGCCGGCGTCCCGGC
CGAGCAGCTGAACTTCGCCTATAGCGTCAGTGGCAGCGCCTCCTGGCGGCCGACCCGCGTCTACAGCGAC
GGCCTCAAGACCTACATCCAGTTTCCGTCGTCGCTCGCCGGACAGGATGCGCCGGTGCTTTTCGTCGAAT
CGGGCGGCAAGGACCGGATCGTCAACTATCGGCTGAAGGGTGACATGATGGTGGTCGATTATCAGATCGA
CACCGCCATTCTGGTCTCCGGCGTGAGCTTTTGGCATCAGGAGAAGGTGACGATCCGGAGGGGAGGCTGA
 Primer design