SecReT4
Protein ID: 92109683
T4SS name [ID]Trb [246]
Gene symbol-
Locus tagNham_4562
StrainNitrobacter hamburgensis X14
Repliconplasmid 3 [GenBank: NC_007961] [Browse all T4SS(s) in this replicon]
Location [Strand]18612..19274 [-]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDQ1QF60
KEGG IDnha:Nham_4562
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2e-44, Aligned region: 13..218
Protein Sequence: 220 a.a.     [Download]
>gi|92109683|ref|YP_571969.1| conjugal transfer protein TrbF [Nitrobacter hamburgensis X14]
MAARNPPDNPYLAARQEWNERYGSYVKAAATWRVVGIVAMLMAVIGFAYALFESTQVKLVPYIVEVDKLG
TAVNAGFPQQIEYADPRVVRATLGSFVSNFRSVTPDAVVQKQYIDRTYALLRTSDPATQKINDWFRSNSP
FEKARTTTVAIEVNNIVALSSQTYQIDWTEFERDRKGKQTGEHRFRGIATVTLTPPQDEQTIRLNPIGLY
LRDFDWTAQL
 
Nucleotide Sequence: 663 bp     [Download]
>gi|92109663|ref|NC_007961.1|:c19274-18612 Nitrobacter hamburgensis X14 plasmid 3, complete sequence
ATGGCCGCGCGTAATCCGCCCGACAATCCCTATCTCGCCGCGCGCCAGGAATGGAACGAGCGCTACGGCT
CCTATGTCAAGGCGGCCGCCACATGGCGCGTCGTCGGCATCGTCGCCATGCTGATGGCGGTGATCGGCTT
CGCCTACGCGTTGTTCGAGAGCACGCAGGTCAAGCTCGTCCCCTACATCGTCGAGGTTGACAAGCTCGGC
ACGGCGGTGAACGCGGGCTTCCCGCAGCAGATCGAATATGCCGATCCACGCGTGGTGCGCGCGACACTCG
GAAGCTTCGTCTCGAACTTCCGCTCGGTGACGCCCGATGCGGTGGTGCAGAAGCAATATATCGATCGGAC
CTACGCGTTGTTGCGAACCTCGGATCCGGCCACGCAGAAGATCAATGACTGGTTTCGCAGCAACTCGCCG
TTCGAGAAGGCGAGGACGACAACGGTCGCCATCGAGGTCAACAACATCGTGGCTCTGTCCAGCCAGACTT
ATCAGATCGACTGGACCGAATTCGAGCGCGACCGGAAAGGAAAGCAAACCGGCGAGCACCGCTTTCGCGG
CATCGCCACTGTGACGCTGACTCCACCCCAGGACGAGCAAACCATCCGGCTCAATCCGATCGGCCTCTAC
CTGCGTGATTTCGACTGGACGGCGCAACTATGA
 Primer design