SecReT4
Protein ID: 92109684
T4SS name [ID]Trb [246]
Gene symbol-
Locus tagNham_4563
StrainNitrobacter hamburgensis X14
Repliconplasmid 3 [GenBank: NC_007961] [Browse all T4SS(s) in this replicon]
Location [Strand]19317..20471 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDQ1QF59
KEGG IDnha:Nham_4563
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.3e-30, Aligned region: 63..276
Protein Sequence: 384 a.a.     [Download]
>gi|92109684|ref|YP_571970.1| conjugal transfer protein TrbL [Nitrobacter hamburgensis X14]
MRGIKPGLVLIIAIGIVIIAHPALAQQDGSVLTTVENSVATATKGWQSTVMQAAKSLFWMLAGIEVGLAA
IWLAIQAASIDAWFAELVRRIMFIGFFAFVLDQGPTFAKAVVDSLYQIGAGGGSASPADVFNAGLKVASS
MSQNAQFGLFQDNALAIASVFAMVIVVISFSLVAAIFVAVMVEMYVGLLAGMIMLGLGGSSFTKDFAIRY
LVYAFSIGMKLMALVMIAKIGSDSLLSLADQTGAGKDAFVTTLAIAGISVVVFIISIYVPNIMQGVVQGV
SVGSGMEVVRHGTQSASFAAGSAALAMGGARAGAAGYSAARADGASFGAAALKGMTEGIGTAGGALASAA
RDRAVGASFGSTTLGLANAKLDRQRAQKSATRKA
 
Nucleotide Sequence: 1155 bp     [Download]
>gi|92109663|ref|NC_007961.1|:c20471-19317 Nitrobacter hamburgensis X14 plasmid 3, complete sequence
GTGCGGGGGATCAAACCGGGGCTCGTCCTGATCATTGCGATCGGCATCGTCATCATTGCGCATCCTGCGT
TGGCGCAACAGGACGGCAGCGTTCTGACAACCGTGGAGAACTCAGTCGCGACGGCCACCAAGGGCTGGCA
GTCGACCGTCATGCAGGCGGCGAAGTCGCTGTTCTGGATGCTCGCCGGCATTGAGGTCGGTCTCGCCGCC
ATCTGGCTCGCCATTCAGGCTGCCTCGATCGACGCGTGGTTCGCCGAACTGGTGCGGCGGATCATGTTCA
TCGGCTTCTTCGCCTTCGTTCTCGACCAGGGACCGACTTTCGCCAAGGCCGTCGTCGACAGCCTCTATCA
GATCGGCGCCGGCGGCGGCTCGGCGTCTCCGGCGGATGTCTTCAATGCCGGTCTCAAGGTCGCGTCCTCG
ATGTCGCAGAACGCGCAGTTTGGCCTGTTCCAGGATAACGCGCTTGCGATCGCATCCGTGTTCGCCATGG
TGATCGTGGTGATCTCGTTCTCGCTCGTCGCGGCGATCTTCGTCGCGGTGATGGTCGAGATGTATGTCGG
CCTCCTTGCCGGCATGATCATGCTCGGCCTCGGCGGCTCGTCCTTCACCAAGGACTTCGCCATCCGCTAC
CTCGTCTACGCCTTCTCCATCGGTATGAAGCTGATGGCGCTGGTGATGATCGCCAAGATCGGGTCCGACA
GCTTGCTGAGTCTCGCCGACCAGACCGGCGCTGGCAAGGACGCCTTCGTCACCACGCTTGCGATCGCCGG
CATCTCGGTCGTCGTCTTCATCATCTCGATCTACGTGCCTAACATCATGCAAGGCGTCGTCCAGGGCGTC
TCCGTCGGCAGCGGCATGGAGGTGGTGCGCCACGGGACACAGTCCGCGAGCTTCGCGGCCGGCAGCGCCG
CGCTTGCCATGGGAGGCGCGCGAGCGGGTGCCGCCGGATACAGCGCCGCGCGTGCCGATGGCGCGTCCTT
CGGCGCGGCCGCCCTCAAGGGCATGACAGAGGGTATCGGAACGGCCGGCGGTGCGCTCGCCTCCGCGGCA
CGTGACCGCGCGGTCGGCGCATCCTTTGGCTCGACCACGCTCGGCCTCGCCAACGCCAAGCTCGACCGGC
AGCGCGCGCAAAAGAGCGCAACCCGAAAGGCCTGA
 Primer design