SecReT4
Protein ID: 92109686
T4SS name [ID]Trb [246]
Gene symbol-
Locus tagNham_4565
StrainNitrobacter hamburgensis X14
Repliconplasmid 3 [GenBank: NC_007961] [Browse all T4SS(s) in this replicon]
Location [Strand]20666..21463 [-]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDQ1QF57
KEGG IDnha:Nham_4565
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 265 a.a.     [Download]
>gi|92109686|ref|YP_571972.1| conjugal transfer protein TrbJ [Nitrobacter hamburgensis X14]
MPRRFSPIHRALIVAFIIGLPTSGPAFAGAAAGGATEFTQILNNGELVSLVGQSTTQINNQIQQISQLAQ
QIQNQLKIYQNMLQNTAQLPSHVWGQAEGDLKQLQSVVNQGQGIAFSMGNIDDVLKQRFQSYAQFKTSLP
NGANFASTYQTWSSTNRDTIAGTLQAAGLTSQQFSTENATMAQLKTASESADGQMKALQVGHEIAAQEVA
QMQKLRGLIAQQTTMMATWFQSSQAGKDLSQARREQFFNATAPVTSGGQTMEPRW
 
Nucleotide Sequence: 798 bp     [Download]
>gi|92109663|ref|NC_007961.1|:c21463-20666 Nitrobacter hamburgensis X14 plasmid 3, complete sequence
ATGCCGAGACGCTTCTCGCCGATTCATAGGGCGCTCATTGTCGCCTTCATCATCGGATTGCCGACGTCAG
GTCCGGCCTTCGCCGGCGCTGCGGCCGGCGGCGCCACCGAGTTCACGCAGATTCTCAACAACGGCGAGTT
GGTCAGCCTCGTCGGGCAGTCGACGACGCAGATCAACAACCAGATTCAGCAGATCTCGCAGCTTGCCCAG
CAGATTCAGAACCAGCTGAAGATCTACCAGAACATGCTGCAGAACACCGCGCAGTTGCCCTCGCATGTCT
GGGGCCAGGCCGAGGGTGATCTCAAACAGCTGCAAAGCGTCGTCAACCAGGGGCAGGGCATCGCGTTTTC
GATGGGCAATATCGACGACGTGCTCAAGCAGCGCTTCCAAAGCTACGCGCAGTTCAAGACCAGCCTGCCG
AACGGCGCGAACTTCGCGTCGACCTATCAGACCTGGTCGTCCACGAACCGCGACACGATCGCCGGCACGC
TCCAGGCCGCGGGTCTCACCTCGCAGCAATTTTCGACCGAGAACGCCACGATGGCGCAACTCAAGACCGC
CTCGGAGAGCGCCGACGGCCAGATGAAGGCCCTGCAGGTTGGCCATGAGATCGCCGCCCAGGAAGTCGCG
CAGATGCAGAAGTTGCGGGGACTGATCGCGCAGCAGACCACGATGATGGCGACCTGGTTCCAGTCCTCGC
AGGCAGGCAAGGACCTGTCGCAGGCGCGCCGCGAGCAGTTCTTCAACGCGACCGCACCGGTGACCTCCGG
CGGCCAGACCATGGAACCGCGCTGGTGA
 Primer design