SecReT4
Protein ID: 92109687
T4SS name [ID]Trb [246]
Gene symbol-
Locus tagNham_4566
StrainNitrobacter hamburgensis X14
Repliconplasmid 3 [GenBank: NC_007961] [Browse all T4SS(s) in this replicon]
Location [Strand]21435..23888 [-]
Productconjugal transfer protein TrbE
Component typeTrbE
UniProt IDQ1QF56
KEGG IDnha:Nham_4566
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 1.5e-52, Aligned region: 192..400
AAA_10 [PF12846], Evalue: 2.6e-31, Aligned region: 457..729
Protein Sequence: 817 a.a.     [Download]
>gi|92109687|ref|YP_571973.1| conjugal transfer protein TrbE [Nitrobacter hamburgensis X14]
MVALRSFRHPSPSFADLVPHAGLVANGIVLLKDGSLMAGWYFAGPDSESSTDAERNEVSRQINTILSRLG
SGWMIQVEAVRVPTTDYPARQDCHFPDPVTRAIDDERRARFEAERGHFESRHAIILTWRPPERRRAGLAR
YIYSDVESRSASYADTAIETFQNAIREIEQYLASVLSIQRMETREVDERDGTRVARYDELFQFIRFCITG
ENHPVRLPDIPMYLDWLATAELQHGLSPMVENRFLGVVAIDGFPAESWPGILNSLDLMPLTYRWSSRFMF
LDDQDARQKLERTRKKWQQKVRPFIDQLFQTQSRSIDQDAAAMVAETEDAIAEASSQLVAYGYYTPVIVL
FDDNSTRLQEKTEAVRRLIQAEGFGARIETLNATEAFLGSLPGNWYANIREPLINTRNLADLIPLNAVWS
GSPTAPCPFYPPNSPPLMQVASGSTPFRMNLHVDDVGHTLVFGPTGSGKSTLLALIAAQFRRYAGAQIFA
FDKGRSMMPLTLAAGGDHYEIGGDDADGSAALAFCPLSDLSTDTDRAWASEWIETLVAVQGVTITPDHRN
AISRQIGLMAEARGRSLSDFVSGVQMREIKDALHHYTVDGPMGQLLDAESDGLELGSFQTFEIEQLMNMG
ERNLVPVLTYLFRRIEKRLTGAPSLIILDEAWLMLGHPVFRDKIREWLKVLRKANCAVLLATQSISDAER
SGIIDVLKESCPTKICLPNGAAREPGTRKFYERIGFNDRQIEIVATAVPKREYYVASPEGRRLFNMALGP
VALSFVGASGKDDLKRILALKKDSTDWPVYWLKERGIGHAETLLADS
 
Nucleotide Sequence: 2454 bp     [Download]
>gi|92109663|ref|NC_007961.1|:c23888-21435 Nitrobacter hamburgensis X14 plasmid 3, complete sequence
ATGGTCGCGCTGCGCTCCTTCCGACACCCCTCGCCGTCCTTCGCCGATCTCGTGCCTCACGCGGGTCTGG
TCGCCAACGGCATCGTCCTGTTGAAGGACGGCTCGCTGATGGCCGGCTGGTATTTCGCGGGGCCGGACTC
GGAGAGCTCGACCGACGCCGAGCGCAACGAGGTCTCGCGCCAGATCAACACTATTCTTTCGCGTCTCGGA
TCCGGCTGGATGATCCAGGTCGAGGCGGTGCGCGTGCCGACCACGGATTATCCGGCACGGCAGGATTGCC
ATTTCCCAGATCCAGTAACGCGCGCGATCGACGACGAACGCCGCGCCCGTTTTGAGGCGGAGAGGGGACA
TTTCGAGAGTCGGCACGCGATCATCCTGACCTGGCGGCCGCCGGAGCGGCGGCGCGCTGGTCTCGCGCGC
TACATCTACTCCGATGTCGAAAGCCGCTCGGCCTCCTATGCCGACACGGCGATCGAGACCTTTCAGAACG
CGATCCGTGAGATCGAGCAATATCTCGCCAGCGTTCTGTCGATCCAGCGCATGGAAACGCGCGAGGTCGA
CGAGCGGGATGGCACGCGCGTCGCGCGCTATGACGAGCTCTTTCAGTTCATCCGCTTCTGTATCACCGGC
GAGAACCATCCGGTCCGCTTGCCGGATATCCCGATGTATCTCGACTGGCTCGCGACCGCCGAACTTCAGC
ACGGCCTGTCGCCCATGGTCGAGAACCGCTTTCTCGGCGTGGTGGCGATCGACGGCTTTCCGGCCGAGAG
CTGGCCGGGGATTCTCAACTCGCTCGATCTGATGCCGCTCACCTATCGCTGGTCGTCGCGTTTCATGTTC
CTCGACGATCAGGATGCCCGCCAGAAGCTCGAGCGCACCCGCAAGAAGTGGCAGCAGAAGGTACGGCCCT
TCATTGACCAACTGTTCCAGACCCAAAGCCGATCGATCGACCAGGATGCGGCCGCGATGGTGGCGGAGAC
GGAGGATGCCATCGCCGAAGCCTCCTCGCAGCTCGTCGCCTATGGCTATTACACGCCGGTCATCGTGCTG
TTCGACGACAACAGCACGCGCCTGCAGGAGAAGACGGAAGCCGTGCGCCGCCTGATCCAGGCGGAAGGTT
TTGGCGCGCGCATCGAGACGCTGAACGCGACCGAAGCCTTCCTCGGCAGCCTGCCGGGTAATTGGTACGC
CAATATCCGCGAGCCACTCATCAACACGCGCAACCTCGCGGACCTCATCCCCCTCAACGCGGTGTGGTCG
GGCAGTCCGACCGCGCCGTGCCCATTTTATCCGCCAAACTCGCCGCCCTTGATGCAGGTCGCGTCCGGCT
CGACACCCTTCCGGATGAACCTTCATGTCGACGATGTCGGGCATACGCTGGTGTTCGGCCCGACCGGCTC
CGGTAAGTCAACCTTGCTGGCGCTGATCGCGGCGCAGTTTCGCCGTTACGCCGGCGCGCAGATCTTCGCT
TTCGACAAGGGCCGCTCGATGATGCCGCTGACGCTCGCCGCCGGCGGCGACCATTACGAGATTGGCGGCG
ACGATGCGGACGGCTCAGCCGCACTCGCCTTTTGTCCCCTCTCCGATTTGTCGACGGACACCGATCGCGC
CTGGGCCTCAGAATGGATCGAGACGCTCGTCGCCGTGCAGGGCGTGACGATCACGCCCGATCACCGCAAT
GCCATCTCGCGACAGATCGGGCTGATGGCCGAGGCGCGCGGGCGATCGCTGTCGGATTTTGTCTCGGGCG
TGCAGATGCGCGAGATCAAGGATGCGCTGCATCATTACACGGTCGACGGCCCCATGGGCCAATTGCTCGA
TGCGGAATCGGACGGGCTGGAGCTCGGATCATTCCAGACCTTCGAGATCGAGCAGTTGATGAACATGGGC
GAGCGCAACCTCGTCCCGGTTCTCACATACCTATTCCGCCGCATCGAAAAGCGGCTGACGGGCGCGCCGA
GCCTGATCATTCTCGATGAGGCCTGGCTGATGCTCGGCCATCCGGTCTTCCGCGACAAGATTCGGGAATG
GCTGAAGGTGCTGCGCAAAGCCAATTGCGCCGTGCTGCTCGCGACGCAGTCGATCTCCGACGCCGAGCGC
TCCGGCATCATCGACGTGCTGAAAGAAAGTTGCCCGACAAAAATTTGCCTGCCGAACGGCGCCGCCCGGG
AGCCCGGGACGCGCAAGTTCTACGAGCGCATCGGCTTCAACGATAGACAGATCGAGATTGTCGCGACCGC
AGTGCCCAAGCGCGAATACTACGTGGCTTCGCCCGAGGGCCGCCGTCTCTTCAACATGGCGCTCGGCCCA
GTCGCGCTGTCCTTCGTCGGCGCATCCGGCAAGGACGACTTGAAGCGCATTTTGGCGCTGAAGAAGGACA
GCACCGATTGGCCCGTTTACTGGCTCAAGGAAAGGGGGATCGGCCATGCCGAGACGCTTCTCGCCGATTC
ATAG
 Primer design