SecReT4
Protein ID: 92109688
T4SS name [ID]Trb [246]
Gene symbol-
Locus tagNham_4567
StrainNitrobacter hamburgensis X14
Repliconplasmid 3 [GenBank: NC_007961] [Browse all T4SS(s) in this replicon]
Location [Strand]23898..24197 [-]
Productconjugal transfer protein TrbD
Component typeTrbD
UniProt IDQ1QF55
KEGG IDnha:Nham_4567
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 3.8e-26, Aligned region: 1..92
Protein Sequence: 99 a.a.     [Download]
>gi|92109688|ref|YP_571974.1| conjugal transfer protein TrbD [Nitrobacter hamburgensis X14]
MAEAGAELRRNRIHRALSRPNLLFGADRELVLLTGLAAVILIFVVLTWYAAILGAAIWIVVVAALRMMAK
ADPMMRRVYARHISYRPNYRATSTPWRRY
 
Nucleotide Sequence: 300 bp     [Download]
>gi|92109663|ref|NC_007961.1|:c24197-23898 Nitrobacter hamburgensis X14 plasmid 3, complete sequence
ATGGCTGAGGCCGGGGCCGAACTCCGACGCAACCGCATTCATCGCGCGCTGTCGCGGCCGAACCTGCTGT
TCGGCGCGGATCGCGAGCTCGTCCTGCTCACGGGCCTCGCCGCCGTGATCCTGATCTTCGTCGTGCTCAC
CTGGTATGCGGCGATCCTCGGCGCCGCGATCTGGATCGTCGTCGTGGCGGCGCTGCGGATGATGGCCAAA
GCCGACCCGATGATGCGGCGCGTCTATGCCCGGCACATCTCCTACCGGCCGAACTACCGGGCGACGTCGA
CGCCCTGGCGGCGTTACTGA
 Primer design