SecReT4
Protein ID: 92109689
T4SS name [ID]Trb [246]
Gene symbol-
Locus tagNham_4568
StrainNitrobacter hamburgensis X14
Repliconplasmid 3 [GenBank: NC_007961] [Browse all T4SS(s) in this replicon]
Location [Strand]24190..24561 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDQ1QF54
KEGG IDnha:Nham_4568
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.8e-21, Aligned region: 6..100
Protein Sequence: 123 a.a.     [Download]
>gi|92109689|ref|YP_571975.1| conjugal transfer protein TrbC [Nitrobacter hamburgensis X14]
MSRDRMMIIGVAGMVFALLLIEPAFASTTGGGNLPWESPLQQIQQSITGPVAGFIALAAVAVAGGMLIFG
GELNDFARRLMYVVLVAGILLGATQIVALFGASGASIGNVAPIADRAGDFGHG
 
Nucleotide Sequence: 372 bp     [Download]
>gi|92109663|ref|NC_007961.1|:c24561-24190 Nitrobacter hamburgensis X14 plasmid 3, complete sequence
ATGTCGCGTGACCGCATGATGATCATCGGCGTCGCCGGCATGGTGTTCGCGCTCTTGCTCATCGAGCCTG
CTTTCGCCTCGACCACTGGCGGCGGCAATCTCCCTTGGGAAAGCCCGCTCCAACAGATCCAGCAATCGAT
CACCGGCCCCGTAGCCGGGTTTATCGCGCTCGCGGCCGTGGCGGTCGCCGGCGGCATGCTGATCTTCGGC
GGCGAGCTCAACGATTTCGCACGACGGCTGATGTATGTCGTGCTCGTCGCCGGCATCCTGCTCGGCGCGA
CGCAGATTGTCGCGCTGTTCGGCGCGAGCGGCGCCTCGATCGGTAACGTCGCGCCGATCGCGGACAGGGC
AGGGGACTTCGGTCATGGCTGA
 Primer design