SecReT4
Protein ID: 92109690
T4SS name [ID]Trb [246]
Gene symbol-
Locus tagNham_4569
StrainNitrobacter hamburgensis X14
Repliconplasmid 3 [GenBank: NC_007961] [Browse all T4SS(s) in this replicon]
Location [Strand]24551..25540 [-]
Productconjugal transfer protein TrbB
Component typeTrbB
UniProt IDQ1QF53
KEGG IDnha:Nham_4569
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.8e-90, Aligned region: 28..295
FtsK_SpoIIIE [PF01580], Evalue: 9.9e-07, Aligned region: 142..197
AAA_19 [PF13245], Evalue: 4.2e-06, Aligned region: 143..186
Protein Sequence: 329 a.a.     [Download]
>gi|92109690|ref|YP_571976.1| conjugal transfer protein TrbB [Nitrobacter hamburgensis X14]
MTAGALVMAELRSHPRLVRKLHDALGDQICAALDDTSVVEVMLNPDGRLFIERLGQGMASAGTMAAATAE
IIIGSVAHALRSEADDERPIISGELPIGGHRFEGLLPPVVGGPAFTIRKRASRLFDLDDYVTQGVMTADQ
VAVVRNAIVSRLNIVVSGGTGSGKTTLANAVIAAIVAHAPEQRLVILEDTAEIQCAAENAVSLHTSDTVD
MARLLKSTMRLRPDRIIVGEVRDGAALTLLKAWNTGHPGGITTIHANSAHSALRRLEQLTAEASQQAMRE
VIGEAVDLIVSIERTDRGRQVRDVLHVESYSAGQYQTESCARKEQRHVA
 
Nucleotide Sequence: 990 bp     [Download]
>gi|92109663|ref|NC_007961.1|:c25540-24551 Nitrobacter hamburgensis X14 plasmid 3, complete sequence
ATGACCGCCGGCGCCCTGGTCATGGCCGAACTTCGTTCCCATCCGCGGCTTGTCCGCAAGCTCCACGACG
CATTGGGCGACCAGATCTGCGCCGCGCTCGACGACACGAGCGTCGTCGAAGTGATGCTCAATCCGGACGG
CCGGCTGTTCATCGAACGGCTCGGGCAGGGGATGGCGTCGGCCGGCACGATGGCGGCTGCGACCGCCGAG
ATCATCATCGGCAGCGTCGCGCACGCGCTGCGATCGGAGGCGGACGACGAGCGCCCGATCATTTCCGGGG
AACTGCCGATCGGCGGCCATCGCTTCGAGGGCCTGCTGCCGCCCGTCGTTGGTGGGCCCGCCTTTACAAT
CCGCAAGCGGGCGTCGCGCCTGTTTGATCTCGATGATTACGTGACGCAAGGCGTCATGACCGCCGACCAG
GTCGCGGTTGTCCGCAATGCCATTGTCTCGCGCCTGAACATCGTGGTGTCCGGGGGCACCGGCTCGGGCA
AGACCACGCTCGCCAATGCCGTGATCGCCGCGATCGTTGCGCATGCGCCGGAACAGCGTCTCGTCATCCT
CGAAGATACGGCCGAGATCCAGTGCGCGGCCGAGAACGCCGTCTCGCTTCACACAAGCGACACGGTCGAC
ATGGCGCGTCTGCTCAAGAGCACGATGCGGCTTCGGCCGGATCGCATCATCGTCGGAGAAGTGCGCGATG
GCGCCGCGCTGACGCTGCTCAAGGCCTGGAACACCGGCCATCCCGGCGGCATCACGACCATCCACGCCAA
CAGCGCCCATTCCGCGCTGCGTCGTCTCGAGCAGCTGACGGCCGAAGCCAGCCAACAGGCCATGCGCGAG
GTCATCGGCGAGGCGGTCGATCTGATCGTCTCGATCGAACGCACGGATCGCGGCCGCCAAGTCCGCGACG
TGCTGCATGTCGAGAGCTACTCGGCAGGCCAGTACCAGACCGAATCCTGCGCCCGGAAGGAGCAGCGCCA
TGTCGCGTGA
 Primer design