SecReT4
Protein ID: 92109772
T4SS name [ID]Trb [246]
Gene symbol-
Locus tagNham_4672
StrainNitrobacter hamburgensis X14
Repliconplasmid 3 [GenBank: NC_007961] [Browse all T4SS(s) in this replicon]
Location [Strand]118888..120813 [-]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDQ1QEX1
KEGG IDnha:Nham_4672
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 6.6e-149, Aligned region: 163..632
TraG-D_C [PF12696], Evalue: 2.6e-31, Aligned region: 478..598
TrwB_AAD_bind [PF10412], Evalue: 2.6e-24, Aligned region: 295..611
AAA_10 [PF12846], Evalue: 4.5e-06, Aligned region: 225..556
Protein Sequence: 641 a.a.     [Download]
>gi|92109772|ref|YP_572058.1| conjugal transfer coupling protein TraG [Nitrobacter hamburgensis X14]
MKARKIALAIAPAILMAVLCLATTGAESWLARFGTTPGGRMLLGRIGLALPYALPAAAAVIFLFAAAGAN
AIRAAGWGVVTGGCLVVVIAASREIARLHSFADAVPAGERLLAYADPSTIGGATIAALVAAFGLRVAMRG
NAAFAAAAPRRIRGRRAIHGESDWMAMTEAARLFAEAGGIVVGERYRVDQDAVADRAFRADEADTWGAGG
KSPLLCFDASFGSSHAIVFAGSGGFKTTSVTVPTALKWGGGLVVLDPSNEVAPMVLTHRRNAGRQAFVLD
PRSPEGGFNVLDWVGQHGATKEEDIAAVASWIMTDNPRQGSARDDFFRASALQLLTALVADICLSGHTEK
KDQHLRQVRANLSEPEPKLRQRLQAIYDNSASGFVKENVAPFIAMTPETFSGVYANAAKETHWLSYANYA
ALVSGSSFTTAELADGQTDIFINLDLKTLENHPGLARVIIGSLLNAIYNRNGEVSGHTLFLLDEVARLGY
LRILETARDAGRKYGITLLMLYQSIGQMREAYGGRDATSKWFESASWISFSAINDPETADYISKRCGDTT
VEADQLSRSSQMSGSSRTRSKQLARRPLIMPHEVLRMRTDEQIVFTAGNPPLRCGRAIWFRRRDMKACTG
QDPYHRSEAVR
 
Nucleotide Sequence: 1926 bp     [Download]
>gi|92109663|ref|NC_007961.1|:c120813-118888 Nitrobacter hamburgensis X14 plasmid 3, complete sequence
ATGAAGGCACGTAAGATCGCCCTCGCGATTGCGCCGGCCATCCTCATGGCGGTGCTGTGCCTCGCCACGA
CCGGTGCGGAATCGTGGCTGGCGCGGTTCGGAACGACGCCGGGCGGCCGGATGCTGCTCGGCCGGATCGG
CCTCGCCCTGCCCTATGCACTGCCGGCCGCAGCCGCCGTCATCTTCCTGTTCGCGGCGGCCGGCGCCAAC
GCGATCCGCGCGGCGGGATGGGGTGTCGTGACCGGCGGCTGTCTCGTCGTCGTCATTGCCGCTTCGCGCG
AGATCGCGCGCCTGCATTCCTTCGCCGACGCCGTGCCGGCCGGAGAACGGCTTCTTGCCTATGCCGATCC
CTCGACCATCGGCGGGGCGACGATCGCGGCGCTCGTGGCCGCGTTCGGATTGCGCGTGGCGATGCGCGGC
AATGCCGCGTTCGCGGCGGCCGCGCCACGCCGCATCCGGGGACGGCGCGCCATCCATGGCGAATCCGACT
GGATGGCGATGACCGAGGCCGCGCGGCTGTTCGCCGAGGCCGGCGGCATCGTGGTCGGCGAGCGCTATCG
CGTCGATCAGGATGCGGTCGCCGACCGTGCCTTTCGCGCCGACGAGGCGGACACATGGGGAGCCGGCGGC
AAATCCCCGCTACTCTGTTTCGATGCCTCCTTCGGCTCGTCGCATGCCATCGTCTTCGCGGGCTCCGGCG
GCTTCAAGACGACGTCTGTGACAGTGCCGACCGCGCTCAAATGGGGTGGCGGCCTGGTCGTCCTCGATCC
GTCCAACGAAGTCGCGCCGATGGTCTTGACGCATCGGCGGAACGCCGGCCGTCAGGCCTTCGTGCTCGAT
CCGCGGTCGCCAGAGGGCGGTTTCAACGTGCTCGACTGGGTCGGTCAGCACGGTGCGACCAAGGAGGAGG
ACATTGCCGCCGTCGCGTCATGGATCATGACCGACAATCCGCGCCAGGGCTCGGCACGGGACGACTTCTT
CCGCGCCTCGGCGCTGCAGCTGCTGACGGCGTTGGTCGCCGACATCTGCCTGTCCGGCCATACGGAAAAG
AAGGACCAGCATCTGCGCCAGGTCCGCGCCAACCTCTCCGAGCCGGAGCCGAAGCTGCGGCAGCGGCTTC
AGGCGATCTACGACAACTCGGCGTCCGGCTTCGTGAAGGAAAACGTCGCGCCGTTCATCGCCATGACGCC
TGAGACGTTCAGCGGCGTCTACGCCAATGCGGCGAAGGAGACGCACTGGCTCTCCTACGCCAACTATGCA
GCGCTGGTGTCGGGATCGAGCTTCACCACCGCCGAGCTCGCGGACGGGCAAACCGACATCTTCATCAACC
TCGACCTGAAGACGCTGGAGAACCATCCGGGCCTCGCCCGCGTCATCATCGGCTCGCTGCTCAACGCCAT
CTACAATCGCAATGGCGAGGTCAGCGGTCACACCCTGTTCCTGCTCGATGAGGTCGCCCGCCTCGGCTAT
CTGCGCATCCTCGAGACTGCCCGCGACGCAGGCCGCAAATACGGCATCACCCTGTTGATGCTCTATCAGT
CGATCGGCCAGATGCGGGAAGCCTATGGCGGCCGCGACGCGACCAGCAAATGGTTCGAGAGCGCGTCCTG
GATCTCGTTCTCGGCTATCAACGATCCCGAGACGGCGGACTACATCTCGAAGCGCTGCGGCGACACCACA
GTCGAGGCTGATCAGCTCAGCCGGTCATCACAAATGTCGGGCTCGTCGCGGACGCGATCGAAACAGCTCG
CCCGGCGCCCGCTGATCATGCCGCATGAGGTCCTGCGCATGCGAACCGACGAGCAGATTGTGTTCACCGC
CGGGAATCCGCCGCTGCGATGCGGACGCGCGATCTGGTTCCGGCGGCGCGATATGAAAGCATGTACCGGC
CAGGACCCGTACCATCGCAGCGAAGCCGTTCGATGA
 Primer design